Clone IP07124 Report

Search the DGRC for IP07124

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:24
Vector:pOT2
Associated Gene/TranscriptCpr64Ac-RA
Protein status:IP07124.pep: gold
Preliminary Size:567
Sequenced Size:908

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15008 2005-01-01 Successful iPCR screen
Cpr64Ac 2008-04-29 Release 5.5 accounting
Cpr64Ac 2008-08-15 Release 5.9 accounting
Cpr64Ac 2008-12-18 5.12 accounting

Clone Sequence Records

IP07124.complete Sequence

908 bp (908 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022677

> IP07124.complete
ACACATCCAAACCAGAGCTCCCTCATTCTCACATCCTTCGCCATGATTGC
CCAGACTCTGTTCGTTTTGGGACTGATCCTGTCCGCCGTTGTGGCCATTC
CCATTGATCCCTATGGACTTTCGGCCCCTGGACTCACCTATGCGGCTCCC
AAGTTGCTTGCTGCTCCTGCCATTTCCTATGCTGCTCCCAAACTCCTGGC
GGCTCCTGCCATCTCGTATGCCGCTCCTGCCATCTCCTATGCTCCCAAGG
TCCTGGCTGCCCCCGTCGCTGTGGCCAAGGTGGCTGTTGCCGAGCCCTAC
GATCCCAATCCGCAGTACAGCTTCTCGTACGGAGTAACCGATCATCACAC
CGGTGACTCCAAGCAGCAGGAGGAGACCCTGGTCAACGGAGTCGTCCACG
GCAGCTACTCCCTGGCCGAACCCGATGGCACTATTCGCAAGGTCACCTAC
ACCGCCGACAAGGTCAACGGATTCAATGCGGTCGTGGAGAAGAAGGGCGT
GGCCGCGGTGGCCATTGCCAAGCCAGCTCTTGCCGTCGCCGCCGTTCCCG
CCATCACCAAGATTGGATACGCTTCGGCGCCTGGTCTGAGTCTGGGTGGA
TACCACTAGGCGATGAACCGGTGGACCAAGCGATGACAAACTCCATGGCC
TAGTTGTAGGACCGTTGTTAAATAGTTCTAATGCATTTACCCACTTTTCT
GTCAGTCAAAACCCGAAACACAAGGACGTGCGTGCTGTTGCCACCCCGCT
GTTGACCCACATTCCCAATCTCCGATCGAAGGATCGCCACCATAGACTAC
GTTTAGGGATACCGTTCTGGGGATCTGGGGAACGGCTATCGGCCACTTAG
TGAATTAGTAACTGCATTTACTGAATAAAAGTTTCGGTACAAAAAAAAAA
AAAAAAAA

IP07124.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ac-RA 1123 Cpr64Ac-RA 197..1095 1..899 4495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4211350..4212189 890..51 4200 100 Minus
chr3L 24539361 chr3L 4212248..4212301 54..1 270 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4211955..4212803 899..51 4245 100 Minus
3L 28110227 3L 4212862..4212915 54..1 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4211955..4212803 899..51 4245 100 Minus
3L 28103327 3L 4212862..4212915 54..1 270 100 Minus
3L 28103327 3L 4208907..4208960 324..271 150 85.1 Minus
Blast to na_te.dros performed on 2019-03-15 17:14:43 has no hits.

IP07124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:15:32 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4211350..4212185 55..890 100 <- Minus
chr3L 4212248..4212301 1..54 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:39 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:45 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:29:22 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:10 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:07 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:08 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:45 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..890 1..890 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:29:22 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..890 1..890 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:10 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..567 43..609 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:07 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ac-RA 1..890 1..890 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:32 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4211964..4212799 55..890 100 <- Minus
3L 4212862..4212915 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:32 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4211964..4212799 55..890 100 <- Minus
3L 4212862..4212915 1..54 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:32 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4211964..4212799 55..890 100 <- Minus
3L 4212862..4212915 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:29:22 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4211964..4212799 55..890 100 <- Minus
arm_3L 4212862..4212915 1..54 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:44 Download gff for IP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4211964..4212799 55..890 100 <- Minus
3L 4212862..4212915 1..54 100   Minus

IP07124.hyp Sequence

Translation from 0 to 608

> IP07124.hyp
THPNQSSLILTSFAMIAQTLFVLGLILSAVVAIPIDPYGLSAPGLTYAAP
KLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPY
DPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTY
TADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIGYASAPGLSLGG
YH*

IP07124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ac-PA 188 CG15008-PA 1..188 15..202 940 100 Plus
Cpr64Aa-PA 192 CG15006-PA 2..139 49..185 285 48.2 Plus
Cpr64Ad-PB 247 CG1259-PB 89..235 47..194 276 48.3 Plus
Ccp84Ab-PA 221 CG1252-PA 9..156 53..196 271 46.1 Plus
Ccp84Aa-PA 205 CG2360-PA 9..156 53..196 269 46.1 Plus

IP07124.pep Sequence

Translation from 0 to 608

> IP07124.pep
THPNQSSLILTSFAMIAQTLFVLGLILSAVVAIPIDPYGLSAPGLTYAAP
KLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPY
DPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTY
TADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPAITKIGYASAPGLSLGG
YH*

IP07124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23875-PA 198 GF23875-PA 1..198 15..202 752 84.3 Plus
Dana\GF23877-PA 204 GF23877-PA 53..204 85..202 267 46.4 Plus
Dana\GF24957-PA 189 GF24957-PA 14..110 85..178 233 53.6 Plus
Dana\GF18457-PA 246 GF18457-PA 47..136 85..174 227 53.3 Plus
Dana\GF23876-PA 119 GF23876-PA 21..114 84..178 218 50.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14205-PA 188 GG14205-PA 1..188 15..202 920 98.9 Plus
Dere\GG14209-PA 195 GG14209-PA 40..120 85..166 258 64.6 Plus
Dere\GG15930-PA 245 GG15930-PA 43..132 85..174 232 53.3 Plus
Dere\GG14556-PA 228 GG14556-PA 14..95 85..166 231 58.5 Plus
Dere\GG15206-PA 255 GG15206-PA 146..226 98..178 226 58 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15543-PA 175 GH15543-PA 1..151 15..188 535 72.4 Plus
Dgri\GH15546-PA 200 GH15546-PA 26..153 66..188 245 55.3 Plus
Dgri\GH15042-PA 191 GH15042-PA 14..95 85..166 230 58.5 Plus
Dgri\GH15545-PA 117 GH15545-PA 13..113 85..184 225 49.5 Plus
Dgri\GH19488-PA 195 GH19488-PA 34..114 91..171 222 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ac-PA 188 CG15008-PA 1..188 15..202 940 100 Plus
Cpr64Aa-PA 192 CG15006-PA 2..139 49..185 285 48.2 Plus
Cpr64Ad-PB 247 CG1259-PB 89..235 47..194 276 48.3 Plus
Ccp84Ab-PA 221 CG1252-PA 9..156 53..196 271 46.1 Plus
Ccp84Aa-PA 205 CG2360-PA 9..156 53..196 269 46.1 Plus
Cpr92A-PA 245 CG6240-PA 6..179 26..202 268 39.6 Plus
Cpr31A-PA 340 CG33302-PA 76..227 38..198 268 44.4 Plus
Cpr62Bb-PC 194 CG13935-PC 14..110 85..178 241 53.6 Plus
Cpr62Bb-PB 194 CG13935-PB 14..110 85..178 241 53.6 Plus
Cpr62Bb-PA 194 CG13935-PA 14..110 85..178 241 53.6 Plus
Ccp84Ae-PA 208 CG1330-PA 9..126 66..181 240 49.2 Plus
Ccp84Ag-PA 191 CG2342-PA 7..128 71..192 239 43.4 Plus
Ccp84Ad-PA 199 CG2341-PA 12..156 58..196 236 41.6 Plus
Cpr62Bc-PB 180 CG1919-PB 48..144 100..197 234 51 Plus
Cpr62Bc-PA 180 CG1919-PA 48..144 100..197 234 51 Plus
Ccp84Af-PA 151 CG1331-PA 12..146 58..180 232 45.3 Plus
CG34461-PB 138 CG34461-PB 2..130 51..184 229 42.5 Plus
CG34461-PA 138 CG34461-PA 2..130 51..184 229 42.5 Plus
Cpr5C-PA 145 CG4052-PA 28..141 67..184 228 47.5 Plus
Cpr64Ab-PA 120 CG15007-PA 16..119 77..185 215 47.7 Plus
Edg84A-PA 188 CG2345-PA 17..116 86..185 215 44 Plus
Cpr66Cb-PA 162 CG7076-PA 83..147 100..164 207 63.1 Plus
Crys-PB 477 CG16963-PB 69..136 98..165 204 60.3 Plus
Crys-PA 477 CG16963-PA 69..136 98..165 204 60.3 Plus
Cpr76Bb-PA 198 CG9290-PA 84..148 104..168 193 63.1 Plus
Ccp84Ac-PA 217 CG1327-PA 58..157 99..192 190 48.5 Plus
Cpr76Bd-PD 1228 CG9299-PD 1109..1209 67..162 188 46.1 Plus
Cpr76Bd-PB 1228 CG9299-PB 1109..1209 67..162 188 46.1 Plus
Cpr76Bd-PC 1231 CG9299-PC 1112..1212 67..162 188 46.1 Plus
Cpr23B-PA 302 CG2973-PA 153..231 102..180 187 51.9 Plus
Cpr30F-PA 146 CG31876-PA 22..146 78..202 183 37.7 Plus
Cpr76Bc-PD 424 CG9295-PD 10..116 69..166 175 41.1 Plus
Cpr76Bc-PC 424 CG9295-PC 10..116 69..166 175 41.1 Plus
Cpr76Ba-PA 204 CG9283-PA 97..163 103..169 159 50.7 Plus
CG13670-PA 266 CG13670-PA 56..164 65..167 158 37.6 Plus
CG34205-PA 217 CG34205-PA 9..214 4..201 154 34.9 Plus
CG42367-PC 103 CG42367-PC 13..101 84..168 147 42.7 Plus
Cpr35B-PA 218 CG3474-PA 66..131 100..165 142 45.5 Plus
Cpr30B-PA 153 CG3818-PA 13..116 85..188 140 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14578-PA 192 GI14578-PA 1..178 15..201 510 67.9 Plus
Dmoj\GI16819-PA 192 GI16819-PA 1..178 15..201 510 67.9 Plus
Dmoj\GI16821-PA 193 GI16821-PA 52..131 87..166 268 68.8 Plus
Dmoj\GI14580-PA 193 GI14580-PA 52..131 87..166 268 68.8 Plus
Dmoj\GI11676-PA 187 GI11676-PA 14..95 85..166 236 59.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12729-PA 184 GL12729-PA 30..103 93..166 240 63.5 Plus
Dper\GL24824-PA 195 GL24824-PA 14..110 85..178 234 54.6 Plus
Dper\GL12836-PA 238 GL12836-PA 129..196 98..165 227 63.2 Plus
Dper\GL22048-PA 315 GL22048-PA 2..118 49..164 212 46.2 Plus
Dper\GL24692-PA 133 GL24692-PA 25..107 68..164 209 49.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13426-PA 191 GA13426-PA 1..191 15..202 613 85.6 Plus
Dpse\GA28205-PA 215 GA28205-PA 57..134 89..166 262 64.1 Plus
Dpse\GA12639-PA 195 GA12639-PA 14..110 85..178 234 54.6 Plus
Dpse\GA28656-PA 242 GA28656-PA 133..200 98..165 227 63.2 Plus
Dpse\GA27359-PA 211 GA27359-PA 20..118 67..164 216 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13997-PA 188 GM13997-PA 1..188 15..202 920 99.5 Plus
Dsec\GM13999-PA 195 GM13999-PA 40..195 85..202 257 45.2 Plus
Dsec\GM26903-PA 245 GM26903-PA 39..136 79..174 233 52 Plus
Dsec\GM14164-PA 225 GM14164-PA 14..95 85..166 231 58.5 Plus
Dsec\GM10912-PA 211 GM10912-PA 22..121 66..165 224 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13278-PA 188 GD13278-PA 1..188 15..202 922 99.5 Plus
Dsim\GD13280-PA 195 GD13280-PA 40..195 85..202 257 45.2 Plus
Dsim\GD17606-PA 192 GD17606-PA 14..95 85..166 234 58.5 Plus
Dsim\GD23798-PA 505 GD23798-PA 106..193 98..185 231 47.7 Plus
Dsim\GD19526-PA 236 GD19526-PA 22..138 66..181 220 47.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12566-PA 272 GJ12566-PA 1..154 15..182 549 74.4 Plus
Dvir\GJ12567-PA 247 GJ12567-PA 57..177 57..166 254 53.3 Plus
Dvir\GJ12946-PA 185 GJ12946-PA 14..110 85..178 232 53.6 Plus
Dvir\GJ23302-PA 256 GJ23302-PA 49..116 98..165 217 61.8 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 34..114 91..171 214 53.1 Plus
Dvir\GJ12566-PA 272 GJ12566-PA 143..248 65..164 207 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10226-PA 205 GK10226-PA 1..205 15..202 608 78.4 Plus
Dwil\GK10248-PA 206 GK10248-PA 36..154 72..185 262 54.9 Plus
Dwil\GK20564-PA 195 GK20564-PA 14..110 85..178 232 54.6 Plus
Dwil\GK12249-PA 228 GK12249-PA 47..136 98..187 223 52.2 Plus
Dwil\GK10832-PA 179 GK10832-PA 47..136 98..187 222 52.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20634-PA 188 GE20634-PA 1..188 15..202 920 98.9 Plus
Dyak\GE20636-PA 195 GE20636-PA 40..195 85..202 258 45.2 Plus
Dyak\GE25835-PA 212 GE25835-PA 22..113 66..165 238 52 Plus
Dyak\GE25123-PA 498 GE25123-PA 38..134 80..174 234 52.6 Plus
Dyak\GE25123-PA 498 GE25123-PA 293..389 80..174 234 52.6 Plus
Dyak\GE20910-PA 229 GE20910-PA 14..95 85..166 230 58.5 Plus