Clone IP07134 Report

Search the DGRC for IP07134

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:34
Vector:pOT2
Associated Gene/Transcriptsowi-RA
Protein status:IP07134.pep: gold
Preliminary Size:600
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15178 2005-01-01 Successful iPCR screen
CG15178 2008-04-29 Release 5.5 accounting
CG15178 2008-08-15 Release 5.9 accounting
CG15178 2008-12-18 5.12 accounting

Clone Sequence Records

IP07134.complete Sequence

838 bp (838 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022678

> IP07134.complete
CTGCCAACCCGAACATAACACAAAAATCACAAAAAAAAAAAAAAAAATTA
GAAAAAGAAAACACACACAAAAAAAAAGTTTCAAAATAAGGAAAAAAATA
ACAAAAAAAACTTTACAAGGAAATAAAAAACATTAAAAAGAATTTAGTTA
TGGAAAACCTAGACGCCACCATAGATAGCATGGAGAACAGTCGGTTTGCA
GCGCTCTACGGGAGTTTGATCAAGGAGTTAACCCTAACTTCGGAGTTGTC
CCAGACGGACATCACCTGTTTGCTCGTCGTTTATTACAAGTTCTCAAAGG
CCAACGGACCGCAGTGCAAGCAGATGACCAAGAAGCAGTTCTATCAGATC
TTCTTGGTGCTCTTCAACGTGGCCAGTGTCCAGGTGATCGAACGCACTCT
GCTCGCGATCACAAAAGATACGAAATATGTCAGTCCCAGGGCCTGGATCC
ACCTCTTCGATCTCTACACAACCAATGACATTCAAGTGCGAATGCGATTT
GCTTTCGAGGTCTATGATACCAAAGGCACTGGCGTTATTGATCGCGAGCA
AGTTGGCACGGCTTGTGAAAAATTTTTTTACGGCGAAGACGAAGATGAAC
TTAATGAACTTAAGGCGGATATGACCGAGTTCCTAATGAAGAAGTTTGAT
CTGGACAAGGACGGAGTCATTTCCTACGAGGACTATTCTACTGTCGTGGA
ACAGCAGCCAATTTTAGTGGAGTTCTTAGGTTGGTTATTTCCATCAAAAG
AGGACAAAGATCTTATGGCCCATTGCATTAACCTGCAACTTAAAATGAAT
TAAATATAATGTTGGTGGTCTTGAAAAAAAAAAAAAAA

IP07134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
sowi-RA 889 sowi-RA 1..826 1..828 4085 99.7 Plus
CG15177-RA 1022 CG15177-RA 299..451 317..469 330 81 Plus
CG15177-RA 1022 CG15177-RA 567..758 582..773 330 78.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2453184..2453693 512..1 2495 99.6 Minus
chr3R 27901430 chr3R 2452732..2452938 823..617 1035 100 Minus
chr3R 27901430 chr3R 2453025..2453135 618..508 555 100 Minus
chr3R 27901430 chr3R 2454664..2454983 469..150 445 75.9 Minus
chr3R 27901430 chr3R 2454252..2454408 773..617 260 77.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6627391..6627900 512..1 2495 99.6 Minus
3R 32079331 3R 6626934..6627145 828..617 1060 100 Minus
3R 32079331 3R 6627232..6627342 618..508 555 100 Minus
3R 32079331 3R 6628871..6629190 469..150 445 75.9 Minus
3R 32079331 3R 6628459..6628615 773..617 260 77.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6368222..6368731 512..1 2505 99.6 Minus
3R 31820162 3R 6367765..6367976 828..617 1060 100 Minus
3R 31820162 3R 6368063..6368173 618..508 555 100 Minus
3R 31820162 3R 6369702..6369854 469..317 330 81 Minus
3R 31820162 3R 6369290..6369446 773..617 260 77.7 Minus
Blast to na_te.dros performed on 2019-03-15 17:14:52 has no hits.

IP07134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:15:37 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2452732..2452937 618..823 100 <- Minus
chr3R 2453026..2453133 510..617 100 <- Minus
chr3R 2453187..2453553 143..509 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:40 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
CG15178-RA 1..654 150..803 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:34 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..654 150..803 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:29:31 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..654 150..803 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:27 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
CG15178-RA 1..654 150..803 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:14 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..654 150..803 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:28 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
CG15178-RA 1..821 1..823 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:34 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..821 1..823 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:29:31 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..821 1..823 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:27 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
CG15178-RA 1..821 1..823 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:14 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
sowi-RA 1..821 1..823 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:37 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6627233..6627340 510..617 100 <- Minus
3R 6626939..6627144 618..823 100 <- Minus
3R 6627394..6627900 1..509 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:37 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6627233..6627340 510..617 100 <- Minus
3R 6626939..6627144 618..823 100 <- Minus
3R 6627394..6627900 1..509 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:37 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6627233..6627340 510..617 100 <- Minus
3R 6626939..6627144 618..823 100 <- Minus
3R 6627394..6627900 1..509 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:29:31 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2452661..2452866 618..823 100 <- Minus
arm_3R 2452955..2453062 510..617 100 <- Minus
arm_3R 2453116..2453622 1..509 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:26 Download gff for IP07134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6368225..6368731 1..509 99   Minus
3R 6367770..6367975 618..823 100 <- Minus
3R 6368064..6368171 510..617 100 <- Minus

IP07134.hyp Sequence

Translation from 149 to 802

> IP07134.hyp
MENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSK
ANGPQCKQMTKKQFYQIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWI
HLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDE
LNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWLFPSK
EDKDLMAHCINLQLKMN*

IP07134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
sowi-PA 217 CG15178-PA 1..217 1..217 1121 100 Plus
CG15177-PA 225 CG15177-PA 1..218 1..217 873 75.2 Plus
CG15177-PB 217 CG15177-PB 1..210 1..217 815 72 Plus
sunz-PA 220 CG15179-PA 1..211 1..213 529 45.1 Plus
d-cup-PA 219 CG14387-PA 3..206 4..209 420 37.9 Plus

IP07134.pep Sequence

Translation from 149 to 802

> IP07134.pep
MENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSK
ANGPQCKQMTKKQFYQIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWI
HLFDLYTTNDIQVRMRFAFEVYDTKGTGVIDREQVGTACEKFFYGEDEDE
LNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGWLFPSK
EDKDLMAHCINLQLKMN*

IP07134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16646-PA 222 GF16646-PA 1..217 1..217 944 76.5 Plus
Dana\GF16647-PA 221 GF16647-PA 1..212 1..212 816 67 Plus
Dana\GF18370-PA 218 GF18370-PA 1..211 1..213 568 47.4 Plus
Dana\GF16917-PA 218 GF16917-PA 3..206 4..209 446 40.3 Plus
Dana\GF11793-PA 253 GF11793-PA 3..223 4..212 379 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10380-PA 217 GG10380-PA 1..217 1..217 1139 98.2 Plus
Dere\GG10369-PA 225 GG10369-PA 1..218 1..217 894 76.1 Plus
Dere\GG13568-PA 220 GG13568-PA 1..211 1..213 549 46 Plus
Dere\GG19247-PA 219 GG19247-PA 3..206 4..209 428 37.4 Plus
Dere\GG22989-PA 244 GG22989-PA 1..222 1..212 372 35.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15665-PA 218 GH15665-PA 1..210 1..212 613 52.4 Plus
Dgri\GH20009-PA 263 GH20009-PA 1..211 1..201 369 36.6 Plus
Dgri\GH24348-PA 348 GH24348-PA 196..335 64..199 149 27.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
sowi-PA 217 CG15178-PA 1..217 1..217 1121 100 Plus
CG15177-PA 225 CG15177-PA 1..218 1..217 873 75.2 Plus
CG15177-PB 217 CG15177-PB 1..210 1..217 815 72 Plus
sunz-PA 220 CG15179-PA 1..211 1..213 529 45.1 Plus
d-cup-PA 219 CG14387-PA 3..206 4..209 420 37.9 Plus
CG3565-PA 244 CG3565-PA 1..222 1..212 374 36 Plus
CG2256-PC 324 CG2256-PC 225..311 114..199 150 36.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22488-PA 220 GI22488-PA 1..212 1..212 610 48.6 Plus
Dmoj\GI19190-PA 221 GI19190-PA 1..220 1..212 440 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22057-PA 224 GL22057-PA 1..212 1..212 841 70.3 Plus
Dper\GL21763-PA 220 GL21763-PA 1..213 1..213 594 48.8 Plus
Dper\GL10228-PA 234 GL10228-PA 1..222 1..212 438 41.4 Plus
Dper\GL26899-PA 351 GL26899-PA 199..338 64..199 151 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13550-PA 224 GA13550-PA 1..212 1..212 841 70.3 Plus
Dpse\GA13552-PA 220 GA13552-PA 1..213 1..213 590 48.8 Plus
Dpse\GA17523-PA 234 GA17523-PA 1..222 1..212 434 41 Plus
Dpse\GA15326-PA 224 GA15326-PA 72..211 64..199 154 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10541-PA 217 GM10541-PA 1..217 1..217 1141 98.6 Plus
Dsec\GM10540-PA 225 GM10540-PA 1..218 1..217 896 75.2 Plus
Dsec\GM10904-PA 220 GM10904-PA 1..211 1..213 544 45.5 Plus
Dsec\GM24064-PA 219 GM24064-PA 3..206 4..209 430 37.9 Plus
Dsec\GM11883-PA 244 GM11883-PA 1..222 1..212 338 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19539-PA 233 GD19539-PA 1..194 1..194 1012 99 Plus
Dsim\GD19538-PA 225 GD19538-PA 1..218 1..217 896 75.2 Plus
Dsim\GD19884-PA 197 GD19884-PA 1..197 1..199 500 45.7 Plus
Dsim\GD18861-PA 219 GD18861-PA 3..206 4..209 430 37.9 Plus
Dsim\GD11881-PA 244 GD11881-PA 1..222 1..212 337 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20255-PA 224 GJ20255-PA 1..222 1..212 459 40.5 Plus
Dvir\GJ10087-PA 158 GJ10087-PA 1..157 1..157 445 47.8 Plus
Dvir\GJ23423-PA 63 GJ23423-PA 1..55 158..212 179 58.2 Plus
Dvir\GJ15601-PA 371 GJ15601-PA 206..361 64..217 152 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11523-PA 219 GK11523-PA 1..213 1..213 764 64.8 Plus
Dwil\GK11579-PA 214 GK11579-PA 1..202 1..202 574 50 Plus
Dwil\GK22790-PA 222 GK22790-PA 3..214 4..212 411 35.8 Plus
Dwil\GK25274-PA 320 GK25274-PA 168..307 64..199 151 27.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24094-PA 207 GE24094-PA 1..207 11..217 1090 98.6 Plus
Dyak\GE24093-PA 225 GE24093-PA 1..218 1..217 895 76.1 Plus
Dyak\GE10232-PA 220 GE10232-PA 1..211 1..213 550 45.5 Plus
Dyak\GE26222-PA 219 GE26222-PA 3..206 4..209 430 37.9 Plus
Dyak\GE14426-PA 244 GE14426-PA 1..222 1..212 342 36 Plus