Clone IP07145 Report

Search the DGRC for IP07145

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:45
Vector:pOT2
Associated Gene/TranscriptCG15479-RA
Protein status:IP07145.pep: gold
Preliminary Size:621
Sequenced Size:865

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15479 2005-01-01 Successful iPCR screen
CG15479 2008-04-29 Release 5.5 accounting
CG15479 2008-08-15 Release 5.9 accounting
CG15479 2008-12-18 5.12 accounting

Clone Sequence Records

IP07145.complete Sequence

865 bp (865 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024372

> IP07145.complete
AACACACATAGCATAACCATAGCATATCATACCATACAATGGAGCACCAT
CAGATCTATCGCCACAAAAAGTTCGACATGGGTCGAAAGATTGAGAAATG
CGATTTGCAGCTGAAGGAAGAGCTAATCTCCCGGAGCGGCACACCCTGCA
CCAGTCGGAGTCCTTTCGATGCGGCAAATCAGTCCGTCAGCTTGGGTTTC
AGTGATCAGGATGCTGACTTTCCTCCACTGCCAAAGCGTCGTCGTTTGGG
ATCCTCATCCTCAAGCGTTTCCTACCAATCCGCCAGCCCCATCATAACCG
AGGCCATCCAAGACATCTTCAAGTACCACGTCAATATGGTGCGAAAATTC
CCGAAGAAGGAGCGTTCACCGAAGGATCAGGAGCGCCGCAACAAGAACAC
AATTGCCTGCAGGATGAGTCGACGGAAGAAGAAGTTCGATGACCTGCAGA
TCGAACAGCAGTACAAGGAGTGCTCCGATGAGCACCTCAAGATCGCCGAA
CAGAGTCTGCGTGCCAGGGTCTATTTGAATCATCTGAAGCAGCTGGTCAA
GCAGGAAGACCACCCGCTAGTATCCTCAAGGAGAGTTCCGGAGGAGAATA
CCAAGAGTAACTTTAGCATCGACTACCTGATAGGTGGTATTAAACAGGAG
CATGCTTAGATACGTCCATCTCCTTTTAGGATTGTATTATATAGTTATTA
TATTAATGCTAAGTTGTTAAGTTTCTTCAAGAACTTTTAGTGCTAAGAAA
TTTAGTATATATTTAGTATAAATGCCTTAAAAGGTTAAGCAGGAACTTCT
TAATAAATAAAATATGAGGATTTAATTTTTACGGCTAAAAAAAACAAAAA
AAAAAAAAAAAAAAA

IP07145.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15479-RA 838 CG15479-RA 1..838 1..838 4190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13232468..13233305 838..1 4190 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13233796..13234633 838..1 4190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13233796..13234633 838..1 4190 100 Minus
Blast to na_te.dros performed 2019-03-16 01:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1061..1203 684..831 124 56.8 Plus

IP07145.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:33:20 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13232468..13233305 1..838 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:41 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..621 39..659 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:59 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..621 39..659 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:38 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..621 39..659 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:58 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..621 39..659 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:36:31 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..621 39..659 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:50 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..838 1..838 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:58 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..838 1..838 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:38 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 28..863 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:58 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 1..838 1..838 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:36:31 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
CG15479-RA 28..863 1..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:20 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13233796..13234633 1..838 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:20 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13233796..13234633 1..838 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:33:20 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13233796..13234633 1..838 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:38 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13233796..13234633 1..838 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:03 Download gff for IP07145.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13233796..13234633 1..838 100   Minus

IP07145.pep Sequence

Translation from 38 to 658

> IP07145.pep
MEHHQIYRHKKFDMGRKIEKCDLQLKEELISRSGTPCTSRSPFDAANQSV
SLGFSDQDADFPPLPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNM
VRKFPKKERSPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHL
KIAEQSLRARVYLNHLKQLVKQEDHPLVSSRRVPEENTKSNFSIDYLIGG
IKQEHA*

IP07145.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21687-PA 215 GF21687-PA 1..213 1..204 647 67.3 Plus
Dana\GF23086-PA 199 GF23086-PA 1..159 1..168 148 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10217-PA 208 GG10217-PA 1..208 1..206 904 88.9 Plus
Dere\GG23826-PA 192 GG23826-PA 1..151 1..168 165 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25114-PA 214 GH25114-PA 13..214 7..206 461 53.8 Plus
Dgri\GH25090-PA 200 GH25090-PA 12..174 7..188 160 30.9 Plus
Dgri\GH22261-PA 200 GH22261-PA 12..174 7..188 160 30.9 Plus
Dgri\GH25089-PA 194 GH25089-PA 89..171 96..177 138 36.1 Plus
Dgri\GH22260-PA 194 GH22260-PA 89..171 96..177 138 36.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Mabi-PA 206 CG15479-PA 1..206 1..206 1069 100 Plus
CG16815-PB 192 CG16815-PB 1..151 1..168 175 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10694-PA 211 GI10694-PA 9..209 7..204 445 54.1 Plus
Dmoj\GI17611-PA 198 GI17611-PA 8..159 7..168 164 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26695-PA 236 GL26695-PA 9..222 5..204 530 56.5 Plus
Dper\GL26308-PA 193 GL26308-PA 4..189 7..194 143 28.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13758-PA 234 GA13758-PA 7..220 3..204 537 56.1 Plus
Dpse\GA14163-PA 193 GA14163-PA 4..189 7..194 143 28.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25716-PA 206 GM25716-PA 1..206 1..206 1059 97.1 Plus
Dsec\GM10290-PA 192 GM10290-PA 1..151 1..168 161 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22077-PA 206 GD22077-PA 1..206 1..206 964 95.1 Plus
Dsim\GD23875-PA 192 GD23875-PA 1..151 1..168 162 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18272-PA 225 GJ18272-PA 11..225 5..206 470 53.9 Plus
Dvir\GJ17955-PA 182 GJ17955-PA 77..159 96..177 153 39.8 Plus
Dvir\GJ17956-PA 207 GJ17956-PA 95..168 96..168 144 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14550-PA 199 GK14550-PA 2..194 5..204 386 50.2 Plus
Dwil\GK14548-PA 177 GK14548-PA 61..137 93..168 153 40.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11787-PA 206 GE11787-PA 1..206 1..206 969 93.7 Plus
Dyak\GE18629-PA 255 GE18629-PA 64..214 1..168 156 31 Plus

IP07145.hyp Sequence

Translation from 38 to 658

> IP07145.hyp
MEHHQIYRHKKFDMGRKIEKCDLQLKEELISRSGTPCTSRSPFDAANQSV
SLGFSDQDADFPPLPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNM
VRKFPKKERSPKDQERRNKNTIACRMSRRKKKFDDLQIEQQYKECSDEHL
KIAEQSLRARVYLNHLKQLVKQEDHPLVSSRRVPEENTKSNFSIDYLIGG
IKQEHA*

IP07145.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15479-PA 206 CG15479-PA 1..206 1..206 1069 100 Plus
CG16815-PB 192 CG16815-PB 1..151 1..168 175 29 Plus