Clone IP07148 Report

Search the DGRC for IP07148

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:48
Vector:pOT2
Associated Gene/TranscriptCG15536-RA
Protein status:IP07148.pep: gold
Preliminary Size:567
Sequenced Size:686

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15536 2005-01-01 Successful iPCR screen
CG15536 2008-04-29 Release 5.5 accounting
CG15536 2008-08-15 Release 5.9 accounting
CG15536 2008-12-18 5.12 accounting

Clone Sequence Records

IP07148.complete Sequence

686 bp (686 high quality bases) assembled on 2006-04-13

GenBank Submission: BT025133

> IP07148.complete
GTTAGTACGTTTTTTCTAATTTTTAATGCCTGGTGAGGCAAATAACACGC
CTCAATCCGGACGGAGACCCCGACTCGGATTGAGTAGGCGTGGTTGCCAG
TCAACGCCCTTAATAAGACTTCAGAGAGACGATTCCGCTGCAAATACACC
AAAATGTAGTGAACAGGAGACTCCGCGGGCACCGCCTTTATCGCTGAGCT
CTCGCAGGATAGGATTGTCCAAAAGCAGGACAGGCTTGTCCAAGAAGAAG
CTAGAGTTTGCTGCGGCCCACGGAATTAAGGACGAGGAACGGGAAATAGT
GAAGAAAACAGCAAAAAAGGATAAAAAGGAAAGGAATGATGCTCAAGAGG
CTCTTGATGCGCCAGAGGAGATACAGGAGCACGGCAACCAGAAGAACCAG
CTTGAAAACAGTCCACAGAGCAGTAAAATCGTTGAGCTACAGGGCGATAT
AGAAATCTGGCGGCAGGGATTCAAAGCTTCTGTGGGTGACCTACTAACTA
TGGCGGAGCCAGGACTCTCAAGAAGCGATCTCCTTACTCGGCTGGGCATT
CCCCACGAGATGCTACGCTATCTGGAGGAGGAGTGTCCATAGTTAAACAT
AGCTTTAAGATTTAACATTAAGAAACTCTATATTCCCATTGCAACAAAGA
GGAAACTAAAAGTTAAAAAAAAAAAAAAAAAAAAAA

IP07148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15536-RA 664 CG15536-RA 1..664 1..664 3320 100 Plus
mRpS18C-RA 643 mRpS18C-RA 512..643 665..534 660 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26247050..26247713 664..1 3320 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30424498..30425162 665..1 3325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30165329..30165993 665..1 3325 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:28:14 has no hits.

IP07148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:29:19 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26247050..26247713 1..664 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:42 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:13 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:25 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:00 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:20 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:34 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:13 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..664 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:25 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..664 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:00 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..567 26..592 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:20 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15536-RA 1..664 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:19 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424499..30425162 1..664 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:19 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424499..30425162 1..664 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:19 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424499..30425162 1..664 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:25 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26250221..26250884 1..664 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:23 Download gff for IP07148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30165330..30165993 1..664 100   Minus

IP07148.pep Sequence

Translation from 25 to 591

> IP07148.pep
MPGEANNTPQSGRRPRLGLSRRGCQSTPLIRLQRDDSAANTPKCSEQETP
RAPPLSLSSRRIGLSKSRTGLSKKKLEFAAAHGIKDEEREIVKKTAKKDK
KERNDAQEALDAPEEIQEHGNQKNQLENSPQSSKIVELQGDIEIWRQGFK
ASVGDLLTMAEPGLSRSDLLTRLGIPHEMLRYLEEECP*

IP07148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16183-PA 199 GF16183-PA 1..199 1..186 461 51.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11939-PA 188 GG11939-PA 1..187 1..187 761 79.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17435-PA 164 GH17435-PA 1..164 1..186 231 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15536-PA 188 CG15536-PA 1..188 1..188 964 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22764-PA 174 GI22764-PA 25..174 26..186 205 35.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14052-PA 226 GL14052-PA 1..226 1..186 382 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13794-PB 187 GA13794-PB 1..187 1..186 419 49.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12159-PA 185 GM12159-PA 1..184 1..187 825 85 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17112-PA 185 GD17112-PA 1..185 1..188 826 85.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22765-PA 175 GJ22765-PA 23..175 24..186 194 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13132-PA 151 GK13132-PA 1..151 1..186 196 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23391-PA 188 GE23391-PA 1..187 1..187 764 81.3 Plus

IP07148.hyp Sequence

Translation from 25 to 591

> IP07148.hyp
MPGEANNTPQSGRRPRLGLSRRGCQSTPLIRLQRDDSAANTPKCSEQETP
RAPPLSLSSRRIGLSKSRTGLSKKKLEFAAAHGIKDEEREIVKKTAKKDK
KERNDAQEALDAPEEIQEHGNQKNQLENSPQSSKIVELQGDIEIWRQGFK
ASVGDLLTMAEPGLSRSDLLTRLGIPHEMLRYLEEECP*

IP07148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG15536-PA 188 CG15536-PA 1..188 1..188 964 100 Plus