BDGP Sequence Production Resources |
Search the DGRC for IP07148
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 71 |
Well: | 48 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15536-RA |
Protein status: | IP07148.pep: gold |
Preliminary Size: | 567 |
Sequenced Size: | 686 |
Gene | Date | Evidence |
---|---|---|
CG15536 | 2005-01-01 | Successful iPCR screen |
CG15536 | 2008-04-29 | Release 5.5 accounting |
CG15536 | 2008-08-15 | Release 5.9 accounting |
CG15536 | 2008-12-18 | 5.12 accounting |
686 bp (686 high quality bases) assembled on 2006-04-13
GenBank Submission: BT025133
> IP07148.complete GTTAGTACGTTTTTTCTAATTTTTAATGCCTGGTGAGGCAAATAACACGC CTCAATCCGGACGGAGACCCCGACTCGGATTGAGTAGGCGTGGTTGCCAG TCAACGCCCTTAATAAGACTTCAGAGAGACGATTCCGCTGCAAATACACC AAAATGTAGTGAACAGGAGACTCCGCGGGCACCGCCTTTATCGCTGAGCT CTCGCAGGATAGGATTGTCCAAAAGCAGGACAGGCTTGTCCAAGAAGAAG CTAGAGTTTGCTGCGGCCCACGGAATTAAGGACGAGGAACGGGAAATAGT GAAGAAAACAGCAAAAAAGGATAAAAAGGAAAGGAATGATGCTCAAGAGG CTCTTGATGCGCCAGAGGAGATACAGGAGCACGGCAACCAGAAGAACCAG CTTGAAAACAGTCCACAGAGCAGTAAAATCGTTGAGCTACAGGGCGATAT AGAAATCTGGCGGCAGGGATTCAAAGCTTCTGTGGGTGACCTACTAACTA TGGCGGAGCCAGGACTCTCAAGAAGCGATCTCCTTACTCGGCTGGGCATT CCCCACGAGATGCTACGCTATCTGGAGGAGGAGTGTCCATAGTTAAACAT AGCTTTAAGATTTAACATTAAGAAACTCTATATTCCCATTGCAACAAAGA GGAAACTAAAAGTTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26247050..26247713 | 664..1 | 3320 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30424498..30425162 | 665..1 | 3325 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 30165329..30165993 | 665..1 | 3325 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26247050..26247713 | 1..664 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..664 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..664 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..567 | 26..592 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15536-RA | 1..664 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424499..30425162 | 1..664 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424499..30425162 | 1..664 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424499..30425162 | 1..664 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26250221..26250884 | 1..664 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30165330..30165993 | 1..664 | 100 | Minus |
Translation from 25 to 591
> IP07148.pep MPGEANNTPQSGRRPRLGLSRRGCQSTPLIRLQRDDSAANTPKCSEQETP RAPPLSLSSRRIGLSKSRTGLSKKKLEFAAAHGIKDEEREIVKKTAKKDK KERNDAQEALDAPEEIQEHGNQKNQLENSPQSSKIVELQGDIEIWRQGFK ASVGDLLTMAEPGLSRSDLLTRLGIPHEMLRYLEEECP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16183-PA | 199 | GF16183-PA | 1..199 | 1..186 | 461 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11939-PA | 188 | GG11939-PA | 1..187 | 1..187 | 761 | 79.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17435-PA | 164 | GH17435-PA | 1..164 | 1..186 | 231 | 40.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15536-PA | 188 | CG15536-PA | 1..188 | 1..188 | 964 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22764-PA | 174 | GI22764-PA | 25..174 | 26..186 | 205 | 35.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14052-PA | 226 | GL14052-PA | 1..226 | 1..186 | 382 | 44.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13794-PB | 187 | GA13794-PB | 1..187 | 1..186 | 419 | 49.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12159-PA | 185 | GM12159-PA | 1..184 | 1..187 | 825 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17112-PA | 185 | GD17112-PA | 1..185 | 1..188 | 826 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22765-PA | 175 | GJ22765-PA | 23..175 | 24..186 | 194 | 34.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13132-PA | 151 | GK13132-PA | 1..151 | 1..186 | 196 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23391-PA | 188 | GE23391-PA | 1..187 | 1..187 | 764 | 81.3 | Plus |
Translation from 25 to 591
> IP07148.hyp MPGEANNTPQSGRRPRLGLSRRGCQSTPLIRLQRDDSAANTPKCSEQETP RAPPLSLSSRRIGLSKSRTGLSKKKLEFAAAHGIKDEEREIVKKTAKKDK KERNDAQEALDAPEEIQEHGNQKNQLENSPQSSKIVELQGDIEIWRQGFK ASVGDLLTMAEPGLSRSDLLTRLGIPHEMLRYLEEECP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15536-PA | 188 | CG15536-PA | 1..188 | 1..188 | 964 | 100 | Plus |