Clone IP07164 Report

Search the DGRC for IP07164

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:64
Vector:pOT2
Associated Gene/TranscriptCG17266-RA
Protein status:IP07164.pep: gold
Preliminary Size:614
Sequenced Size:679

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17266 2005-01-01 Successful iPCR screen
CG17266 2008-04-29 Release 5.5 accounting
CG17266 2008-08-15 Release 5.9 accounting
CG17266 2008-12-18 5.12 accounting

Clone Sequence Records

IP07164.complete Sequence

679 bp (679 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022685

> IP07164.complete
TAAAATCTTAATCTTGACTTGTTAGAAAGTTTATAAACAAATAAAATAAT
TTTAAAATGCCTAACTGGAATCAAATACAGTCCCAACTGAGAAGCTCCAA
CAATCCCGTCGTTTTCTTCGACATTGCCGTAGGCACAACGGAAATCGGAC
GAATGATATTCGAACTCTTTGCGGACACAGTGCCCCGCACGGCGGAAAAC
TTCCGGCAGTTCTGCACGGGCGAGTACCGACCGGATGGCGTTCCCATTGG
CTACAAAGGCGCCAGTTTCCATCGGGTGATCAAGGACTTCATGATCCAGG
GCGGCGACTTTGTGCAGGGCGACGGCACCGGCGTGACCAGCATATACGGC
AACACCTTCGGCGACGAGAACTTTACCCTGAAGCACGACTCGCCCGGCCT
CCTTTCCATGGCAAACAGTGGCAAGGAGACGAACGGCTGCCAATTCTTTA
TCACCTGCGCCAAGTGCAACTTTTTAGACGGAAAGCACGTGGTGTTCGGT
CGGGTTCTGGATGGACTGCTCATCATGCGCAAGATCGAGAACGTGCCCAC
GGGCCCCAATAACAAGCCGAAGCTCCCAGTGACCATTTCGCAGTGCGGGC
AAATGTAGCACGGAGTTCTAAATGTTGTAATAAAGTCTCTATTATGTCTT
TTTAAAAAAAAAAAAAAAAAAAAAAAAAA

IP07164.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17266-RA 916 CG17266-RA 256..911 1..656 3280 100 Plus
CG3271-RA 1442 CG3271-RA 1323..1442 656..537 600 100 Minus
CG3271-RB 1444 CG3271-RB 1325..1444 656..537 600 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2562225..2562738 653..140 2570 100 Minus
chr2R 21145070 chr2R 2562803..2562943 141..1 705 100 Minus
chr2R 21145070 chr2R 18531858..18532063 455..250 220 73.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6675025..6675541 656..140 2585 100 Minus
2R 25286936 2R 6675606..6675746 141..1 705 100 Minus
2R 25286936 2R 22645330..22645535 455..250 220 73.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6676224..6676740 656..140 2585 100 Minus
2R 25260384 2R 6676805..6676945 141..1 705 100 Minus
2R 25260384 2R 22646651..22646734 333..250 195 82.1 Minus
Blast to na_te.dros performed 2019-03-16 08:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 95..134 57..19 107 77.5 Minus

IP07164.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:28 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2562225..2562737 141..653 100 <- Minus
chr2R 2562804..2562943 1..140 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:45 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 1..552 57..608 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:24 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 1..552 57..608 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:57 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 1..552 57..608 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:11 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 1..552 57..608 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:26 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 1..552 57..608 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:10 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 7..614 1..608 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:24 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 215..867 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:57 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 256..908 1..653 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:11 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 7..614 1..608 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:26 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
CG17266-RA 256..908 1..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:28 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6675028..6675540 141..653 100 <- Minus
2R 6675607..6675746 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:28 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6675028..6675540 141..653 100 <- Minus
2R 6675607..6675746 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:28 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6675028..6675540 141..653 100 <- Minus
2R 6675607..6675746 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:57 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2562533..2563045 141..653 100 <- Minus
arm_2R 2563112..2563251 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:24 Download gff for IP07164.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6676227..6676739 141..653 100 <- Minus
2R 6676806..6676945 1..140 100   Minus

IP07164.hyp Sequence

Translation from 56 to 607

> IP07164.hyp
MPNWNQIQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFR
QFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNT
FGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRV
LDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM*

IP07164.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17266-PB 183 CG17266-PB 1..183 1..183 985 100 Plus
CG17266-PA 183 CG17266-PA 1..183 1..183 985 100 Plus
CG2852-PD 205 CG2852-PD 31..190 19..183 454 53.9 Plus
CG2852-PA 205 CG2852-PA 31..190 19..183 454 53.9 Plus
CG7768-PB 164 CG7768-PB 4..164 17..183 443 53.3 Plus

IP07164.pep Sequence

Translation from 56 to 607

> IP07164.pep
MPNWNQIQSQLRSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFR
QFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTGVTSIYGNT
FGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRV
LDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM*

IP07164.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13802-PA 183 GF13802-PA 1..183 1..183 964 98.4 Plus
Dana\GF18880-PA 946 GF18880-PA 9..182 13..183 485 52.9 Plus
Dana\GF13003-PA 205 GF13003-PA 31..190 19..183 455 53.3 Plus
Dana\GF11346-PA 394 GF11346-PA 232..393 16..183 446 54.2 Plus
Dana\GF19040-PA 155 GF19040-PA 8..155 30..183 401 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10814-PA 183 GG10814-PA 1..183 1..183 969 99.5 Plus
Dere\GG11596-PA 955 GG11596-PA 16..182 20..183 476 53.3 Plus
Dere\GG21776-PA 205 GG21776-PA 31..190 19..183 457 53.3 Plus
Dere\GG21795-PA 300 GG21795-PA 138..299 16..183 445 53.6 Plus
Dere\GG19332-PA 227 GG19332-PA 62..227 12..183 427 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20149-PA 183 GH20149-PA 1..183 1..183 958 97.3 Plus
Dgri\GH17446-PA 912 GH17446-PA 9..182 13..183 482 52.6 Plus
Dgri\GH14843-PA 164 GH14843-PA 4..164 17..183 444 53.3 Plus
Dgri\GH20332-PA 205 GH20332-PA 31..190 19..183 444 52.7 Plus
Dgri\GH17842-PA 165 GH17842-PA 2..165 14..183 433 51.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17266-PB 183 CG17266-PB 1..183 1..183 985 100 Plus
CG17266-PA 183 CG17266-PA 1..183 1..183 985 100 Plus
Moca-cyp-PA 970 CG1866-PA 10..182 14..183 461 52 Plus
CG2852-PD 205 CG2852-PD 31..190 19..183 454 53.9 Plus
CG2852-PA 205 CG2852-PA 31..190 19..183 454 53.9 Plus
cyp33-PA 300 CG4886-PA 138..299 16..183 451 54.2 Plus
CG7768-PB 164 CG7768-PB 4..164 17..183 443 53.3 Plus
CG7768-PA 164 CG7768-PA 4..164 17..183 443 53.3 Plus
Cyp1-PA 227 CG9916-PA 62..207 12..162 424 55.6 Plus
CG8336-PD 383 CG8336-PD 12..183 14..183 398 48 Plus
CG8336-PC 383 CG8336-PC 12..183 14..183 398 48 Plus
CG8336-PA 383 CG8336-PA 12..183 14..183 398 48 Plus
CG8336-PB 383 CG8336-PB 12..183 14..183 398 48 Plus
ninaA-PA 237 CG3966-PA 29..191 19..183 375 44.3 Plus
Cypl-PA 176 CG13892-PA 27..168 28..177 311 45 Plus
CG7747-PA 517 CG7747-PA 286..421 28..171 300 43.4 Plus
CG3511-PB 637 CG3511-PB 480..624 19..171 266 43.9 Plus
CG3511-PA 637 CG3511-PA 480..624 19..171 266 43.9 Plus
CG11777-PA 161 CG11777-PA 7..140 28..169 253 40.6 Plus
CG10907-PA 502 CG10907-PA 19..146 28..162 245 42.3 Plus
CG5808-PA 653 CG5808-PA 7..157 28..178 165 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20240-PA 183 GI20240-PA 1..183 1..183 954 96.7 Plus
Dmoj\GI22772-PA 911 GI22772-PA 10..183 13..183 483 52.6 Plus
Dmoj\GI13614-PA 164 GI13614-PA 4..164 17..183 457 54.5 Plus
Dmoj\moj29-PA 205 GI20003-PA 31..190 19..183 449 53.3 Plus
Dmoj\GI13698-PA 165 GI13698-PA 2..165 14..183 443 52.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10991-PA 183 GL10991-PA 1..183 1..183 961 98.4 Plus
Dper\GL23654-PA 939 GL23654-PA 9..182 13..183 484 52.9 Plus
Dper\GL17482-PA 205 GL17482-PA 31..190 19..183 453 53.3 Plus
Dper\GL11464-PA 302 GL11464-PA 140..301 16..183 443 53.6 Plus
Dper\GL16395-PA 236 GL16395-PA 28..190 19..183 382 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14426-PA 183 GA14426-PA 1..183 1..183 961 98.4 Plus
Dpse\GA15038-PA 930 GA15038-PA 9..182 13..183 481 52.9 Plus
Dpse\GA15486-PA 205 GA15486-PA 31..190 19..183 453 53.3 Plus
Dpse\GA18502-PA 302 GA18502-PA 140..301 16..183 443 53.6 Plus
Dpse\Cyp1-PA 226 GA22120-PA 61..226 12..183 426 51.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20863-PA 183 GM20863-PA 1..183 1..183 974 100 Plus
Dsec\GM16379-PA 963 GM16379-PA 10..182 14..183 476 52 Plus
Dsec\GM15627-PA 205 GM15627-PA 31..190 19..183 464 53.9 Plus
Dsec\GM21798-PA 301 GM21798-PA 139..300 16..183 447 53.6 Plus
Dsec\GM25460-PA 164 GM25460-PA 4..164 17..183 441 53.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10314-PA 183 GD10314-PA 1..183 1..183 974 100 Plus
Dsim\GD21371-PA 1003 GD21371-PA 10..182 14..183 475 52 Plus
Dsim\GD25116-PA 203 GD25116-PA 29..188 19..183 464 53.9 Plus
Dsim\GD11288-PA 301 GD11288-PA 139..300 16..183 447 53.6 Plus
Dsim\GD20227-PA 155 GD20227-PA 8..155 30..183 386 50.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20192-PA 183 GJ20192-PA 1..183 1..183 962 97.8 Plus
Dvir\GJ22774-PA 930 GJ22774-PA 9..182 13..183 482 52.6 Plus
Dvir\GJ13951-PA 164 GJ13951-PA 4..164 17..183 463 54.5 Plus
Dvir\GJ21252-PA 206 GJ21252-PA 32..191 19..183 451 52.7 Plus
Dvir\GJ14038-PA 164 GJ14038-PA 4..164 17..183 446 53.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23148-PA 183 GK23148-PA 1..183 1..183 924 94 Plus
Dwil\GK12144-PA 847 GK12144-PA 9..176 13..183 467 50.9 Plus
Dwil\GK21428-PA 204 GK21428-PA 30..189 19..183 451 52.7 Plus
Dwil\GK14585-PA 165 GK14585-PA 5..165 17..183 441 52.7 Plus
Dwil\GK16511-PA 165 GK16511-PA 2..165 14..183 438 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24621-PA 183 GE24621-PA 1..183 1..183 969 99.5 Plus
Dyak\Moca-cyp-PA 970 GE23785-PA 10..182 14..183 481 51.4 Plus
Dyak\GE11851-PA 205 GE11851-PA 31..190 19..183 462 53.9 Plus
Dyak\GE11871-PA 300 GE11871-PA 138..299 16..183 447 53.6 Plus
Dyak\GE22008-PA 180 GE22008-PA 20..180 17..183 446 53.9 Plus