Clone IP07170 Report

Search the DGRC for IP07170

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:70
Vector:pOT2
Associated Gene/TranscriptCG18536-RB
Protein status:IP07170.pep: wuzgold
Preliminary Size:576
Sequenced Size:700

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18536 2005-01-01 Successful iPCR screen
CG18536 2008-04-29 Release 5.5 accounting
CG18536 2008-08-15 Release 5.9 accounting
CG18536 2008-12-18 5.12 accounting

Clone Sequence Records

IP07170.complete Sequence

700 bp (700 high quality bases) assembled on 2006-09-15

GenBank Submission: BT029061

> IP07170.complete
CACACTGCAAAAGTGTAGTGGCTACTTGAGAAACTGGCACGAAAAAAACG
CCACTCGAGTGGGCCAAAATGATGACAATAAAATAATTACGCTCTTATCA
CCCACTAAATACAGTGGAGGAAGCGAAAATGGGACTACGAGCCTATATTA
TTAACCGCAACCTCTTCGGATGAAAGCAAGCTTATTTGAAGCTAAAATCG
AACGTCTGGGGCGTTCAGATTACGGACTTTCGGCCATCTTAGAGTGGAAA
TATGACACGAATGAGGAAACGATGGTTGAGGCACAAGCGTATCGCAGTAA
TTCGGGCGATGAGAGTGATTACAAGCTGCTACCCTGGGCAATACCCAAAC
AGCCCTTCTATGATTACATCAACACCTACTATAAGGATGTGATCTCAAAA
AACCTCGGCTACTGCTCCAATCTACCCAAATACGAAGATAAATTTCAGCC
TCCCTGGCCAAAGAACACCTATAAGCTTGACAAGTGCAAAATCGGTGGTG
ATGGATTGCCGGAAATCGCTCCGCCAGGATTCTACAAGATCGTATTCACT
AAATTTGGTCCTGGGCAGCCAACTTGGGGTTTCACAGCCGTTTTTAAGCT
GACTAACAAAATTTTCTAGATATGTTAATATTTAAGATTCTATTTTTTTA
TAATCCTATAAATAAATCCAATGAGTAATAAAAAAAAAAAAAAAAAAAAA

IP07170.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-RB 681 CG18536-RB 1..681 1..679 3350 99.7 Plus
CG18536-RA 788 CG18536-RA 231..788 124..679 2735 99.6 Plus
CG14502-RC 903 CG14502-RC 5..127 1..123 615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14182319..14182724 274..679 2030 100 Plus
chr2R 21145070 chr2R 14182109..14182265 122..276 705 98.1 Plus
chr2R 21145070 chr2R 14176162..14176284 1..123 615 100 Plus
chr2R 21145070 chr2R 14183369..14183469 293..393 205 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18295253..18295661 274..682 2045 100 Plus
2R 25286936 2R 18295043..18295199 122..276 720 98.7 Plus
2R 25286936 2R 18289092..18289214 1..123 615 100 Plus
2R 25286936 2R 18296307..18296407 293..393 205 80.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18296452..18296860 274..682 2045 100 Plus
2R 25260384 2R 18296242..18296398 122..276 730 98.7 Plus
2R 25260384 2R 18290291..18290413 1..123 615 100 Plus
2R 25260384 2R 18297506..18297606 293..393 205 80.1 Plus
Blast to na_te.dros performed on 2019-03-16 06:03:45 has no hits.

IP07170.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:31 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14176162..14176284 1..123 100 -> Plus
chr2R 14182111..14182263 124..274 98 -> Plus
chr2R 14182320..14182724 275..679 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:47 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 79..576 124..619 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:27:01 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 79..576 124..619 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:15:36 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 79..576 124..619 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:48:51 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 79..576 124..619 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:14:50 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 79..576 124..619 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:57:10 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RB 1..681 1..679 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:27:01 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RB 1..681 1..679 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:36 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 231..788 124..679 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:48:51 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RB 1..681 1..679 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:14:50 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 231..788 124..679 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:31 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18289092..18289214 1..123 100 -> Plus
2R 18295045..18295197 124..274 98 -> Plus
2R 18295254..18295658 275..679 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:31 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18289092..18289214 1..123 100 -> Plus
2R 18295045..18295197 124..274 98 -> Plus
2R 18295254..18295658 275..679 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:31 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18289092..18289214 1..123 100 -> Plus
2R 18295045..18295197 124..274 98 -> Plus
2R 18295254..18295658 275..679 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:36 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14182550..14182702 124..274 98 -> Plus
arm_2R 14176597..14176719 1..123 100 -> Plus
arm_2R 14182759..14183163 275..679 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:43 Download gff for IP07170.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18290291..18290413 1..123 100 -> Plus
2R 18296244..18296396 124..274 98 -> Plus
2R 18296453..18296857 275..679 100   Plus

IP07170.pep Sequence

Translation from 169 to 618

> IP07170.pep
MKASLFEAKIERLGRSDYGLSAILEWKYDTNEETMVEAQAYRSNSGDESD
YKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNT
YKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKIF*

IP07170.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12154-PA 192 GF12154-PA 50..192 8..149 618 76.9 Plus
Dana\GF12151-PA 189 GF12151-PA 50..189 8..149 423 54.2 Plus
Dana\GF12153-PA 126 GF12153-PA 3..125 24..148 404 56 Plus
Dana\GF12152-PA 120 GF12152-PA 2..120 31..149 317 47.1 Plus
Dana\GF21782-PA 212 GF21782-PA 12..123 7..120 204 36 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21867-PA 191 GG21867-PA 48..191 6..149 669 83.3 Plus
Dere\GG21868-PA 188 GG21868-PA 45..188 6..149 508 59.7 Plus
Dere\GG21869-PA 181 GG21869-PA 38..181 6..149 485 59 Plus
Dere\GG21870-PA 185 GG21870-PA 46..185 8..149 455 54.2 Plus
Dere\GG21866-PA 188 GG21866-PA 47..188 6..149 438 53.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21658-PA 164 GH21658-PA 22..159 6..147 322 43 Plus
Dgri\GH21661-PA 164 GH21661-PA 21..159 5..147 321 44.1 Plus
Dgri\GH21657-PA 185 GH21657-PA 43..179 6..147 275 43 Plus
Dgri\GH22995-PA 99 GH22995-PA 51..99 10..58 134 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-PA 191 CG18536-PA 48..191 6..149 799 100 Plus
CG18537-PA 188 CG18537-PA 46..188 7..149 545 65.7 Plus
CG18539-PB 185 CG18539-PB 47..184 9..148 464 54.3 Plus
CG14502-PD 188 CG14502-PD 49..187 8..148 431 51.8 Plus
CG14502-PC 188 CG14502-PC 49..187 8..148 431 51.8 Plus
CG14502-PB 188 CG14502-PB 49..187 8..148 431 51.8 Plus
CG14502-PA 188 CG14502-PA 49..187 8..148 431 51.8 Plus
CG18538-PA 182 CG18538-PA 39..181 7..148 423 56.6 Plus
CG18539-PC 126 CG18539-PC 3..125 24..148 414 52.8 Plus
CG18540-PB 190 CG18540-PB 50..164 9..123 337 50.4 Plus
CG34028-PA 189 CG34028-PA 51..189 7..149 224 34.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20111-PA 164 GI20111-PA 22..159 6..147 394 52.1 Plus
Dmoj\GI20114-PA 183 GI20114-PA 42..178 6..147 370 50 Plus
Dmoj\GI20113-PA 167 GI20113-PA 23..161 5..147 347 46.9 Plus
Dmoj\GI23934-PA 163 GI23934-PA 20..163 4..149 288 37 Plus
Dmoj\GI20112-PA 110 GI20112-PA 1..110 36..149 266 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17760-PA 186 GL17760-PA 44..186 7..149 550 67.1 Plus
Dper\GL17761-PA 189 GL17761-PA 46..189 6..149 509 61.1 Plus
Dper\GL19354-PA 186 GL19354-PA 45..186 8..149 472 59.9 Plus
Dper\GL17759-PA 214 GL17759-PA 73..214 6..149 442 53.5 Plus
Dper\GL17762-PA 191 GL17762-PA 52..191 8..149 435 53.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14977-PA 186 GA14977-PA 44..186 7..149 544 66.4 Plus
Dpse\GA24903-PA 186 GA24903-PA 43..186 6..149 515 63.2 Plus
Dpse\GA25932-PA 186 GA25932-PA 45..186 8..149 478 60.6 Plus
Dpse\GA13036-PA 188 GA13036-PA 47..188 6..149 445 53.5 Plus
Dpse\GA14980-PA 191 GA14980-PA 52..191 8..149 443 54.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21862-PA 181 GM21862-PA 38..181 6..149 477 58.3 Plus
Dsec\GM21863-PA 173 GM21863-PA 34..173 8..149 450 52.8 Plus
Dsec\GM21861-PA 268 GM21861-PA 137..263 6..134 439 64.3 Plus
Dsec\GM21860-PA 188 GM21860-PA 47..187 6..148 428 53.1 Plus
Dsec\GM21864-PA 146 GM21864-PA 6..146 9..149 350 46.9 Plus
Dsec\GM21861-PA 268 GM21861-PA 48..115 6..73 344 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11357-PA 191 GD11357-PA 48..191 6..149 726 94.4 Plus
Dsim\GD11358-PA 188 GD11358-PA 45..188 6..149 515 64.6 Plus
Dsim\GD11359-PA 313 GD11359-PA 170..313 6..149 476 58.3 Plus
Dsim\GD11356-PA 188 GD11356-PA 49..188 8..149 432 53.5 Plus
Dsim\GD11359-PA 313 GD11359-PA 38..148 6..116 371 59.5 Plus
Dsim\GD11361-PA 158 GD11361-PA 18..158 9..149 341 45.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22468-PA 190 GJ22468-PA 50..185 8..147 400 52.9 Plus
Dvir\GJ19880-PA 190 GJ19880-PA 48..185 6..147 379 48.6 Plus
Dvir\GJ19881-PA 190 GJ19881-PA 48..185 6..147 366 51.4 Plus
Dvir\GJ19884-PA 201 GJ19884-PA 47..194 8..145 358 48.7 Plus
Dvir\GJ19882-PA 187 GJ19882-PA 45..181 6..147 355 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22974-PA 186 GK22974-PA 46..186 7..149 479 59.4 Plus
Dwil\GK22973-PA 188 GK22973-PA 49..188 8..149 370 46.5 Plus
Dwil\GK22976-PA 173 GK22976-PA 24..143 6..125 360 50 Plus
Dwil\GK25378-PA 186 GK25378-PA 48..169 7..130 222 36.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11944-PA 191 GE11944-PA 48..191 6..149 687 86.8 Plus
Dyak\GE11945-PA 188 GE11945-PA 45..188 6..149 519 62.5 Plus
Dyak\GE11946-PA 188 GE11946-PA 45..184 6..145 493 62.1 Plus
Dyak\GE11947-PA 168 GE11947-PA 29..168 8..149 444 52.1 Plus
Dyak\GE11943-PA 188 GE11943-PA 49..188 8..149 441 54.2 Plus

IP07170.hyp Sequence

Translation from 271 to 618

> IP07170.hyp
MVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSN
LPKYEDKFQPPWPKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQP
TWGFTAVFKLTNKIF*

IP07170.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-PA 191 CG18536-PA 77..191 1..115 647 100 Plus
CG18537-PA 188 CG18537-PA 74..188 1..115 452 67 Plus
CG18538-PA 182 CG18538-PA 69..181 2..114 409 64.6 Plus
CG18539-PC 126 CG18539-PC 14..125 1..114 375 53.5 Plus
CG18539-PB 185 CG18539-PB 73..184 1..114 375 53.5 Plus