Clone IP07182 Report

Search the DGRC for IP07182

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:82
Vector:pOT2
Associated Gene/TranscriptCG30075-RA
Protein status:IP07182.pep: gold
Preliminary Size:588
Sequenced Size:752

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30075-RA 2009-01-21 est gleaning

Clone Sequence Records

IP07182.complete Sequence

752 bp assembled on 2009-06-05

GenBank Submission: BT088768.1

> IP07182.complete
CACTTGCTTTTGTGTGTTAAATAAGAAAATACTTATATTGCAAAATGCTC
CCCAACGATAAAAAAGGTTTTAAAGCAGCAAAGAACGATAAGTTCTCGAC
CCATGCCCTCCTCAATGAGAATGACAACGACCAATCACTAAGCTCCGATG
AGCAGGACGACATATTTTTCCTGATCTATCGGAAGGCACATACTTTGTTC
CAGGCAGGAAAGTTATGGATGAGGCGTATGCGTTATCACGATGCACAAAG
GGCATTTGAGAAAGCGATAACACGCTTGAAAACTTGCAAAACTAGCAGTT
TCGAACAGCAGTGCCGTAAAAAAGATATGCTTATCGCCCTTTTCGAAAGC
TTGATGATCTGCTTCAACAAGATGAGGCAGTCCAGGTGCGTCTGCTATGT
CATGAAGGAACTTCGTCTCCTGACCATCAATAATCCTTCGGCTTTGGCGC
TCTGTCAGCACGGTCGTGCCCTAAGCGACTTGGGTAAATACCATCCATCC
CGTTTGTGCTACATAAAGGCGTTGAAAAAACGTCCTAGAGACCAGGGTAT
CAAGGATAAGATTACCAGAATCAGCAAGAGAATCACAGAACTTGAGGATA
CCAATCAGATGCTTTCTCAGCTGAGTATATAACAAAAAATCTACTGAAAT
CTTCATATAGAAAGCAATAAGCTATCAGTTAATAATAAATATCCTTAAAA
CTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

IP07182.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG30075.a 751 CG30075.a 46..751 1..706 3530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10263299..10263981 21..703 3400 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14375995..14376680 21..706 3415 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14377194..14377879 21..706 3415 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 23:00:31 has no hits.

IP07182.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:01:13 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10263225..10263248 1..24 100 -> Plus
chr2R 10263303..10263981 25..703 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:02 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..588 45..632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:57 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..588 45..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:04 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..588 45..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:17:35 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..588 45..632 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-05 17:11:12 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..588 45..632 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:57 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..703 1..703 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:04 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..703 1..703 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:17:35 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
CG30075-RA 1..703 1..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:13 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14375921..14375944 1..24 100 -> Plus
2R 14375999..14376677 25..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:13 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14375921..14375944 1..24 100 -> Plus
2R 14375999..14376677 25..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:13 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14375921..14375944 1..24 100 -> Plus
2R 14375999..14376677 25..703 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:04 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10263426..10263449 1..24 100 -> Plus
arm_2R 10263504..10264182 25..703 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:21 Download gff for IP07182.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14377198..14377876 25..703 100   Plus
2R 14377120..14377143 1..24 100 -> Plus

IP07182.hyp Sequence

Translation from 44 to 631

> IP07182.hyp
MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHT
LFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALF
ESLMICFNKMRQSRCVCYVMKELRLLTINNPSALALCQHGRALSDLGKYH
PSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQMLSQLSI*

IP07182.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30075-PA 195 CG30075-PA 1..195 1..195 1014 100 Plus
shu-PA 455 CG4735-PA 206..358 36..188 282 38.6 Plus

IP07182.pep Sequence

Translation from 44 to 631

> IP07182.pep
MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHT
LFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALF
ESLMICFNKMRQSRCVCYVMKELRLLTINNPSALALCQHGRALSDLGKYH
PSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQMLSQLSI*

IP07182.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12456-PA 453 GF12456-PA 207..361 36..190 298 40.6 Plus
Dana\GF19503-PA 334 GF19503-PA 100..300 1..188 171 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20452-PA 195 GG20452-PA 1..195 1..195 594 58.5 Plus
Dere\GG19994-PA 453 GG19994-PA 204..358 36..190 301 38.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22913-PA 465 GH22913-PA 196..354 28..184 272 36.5 Plus
Dgri\GH24794-PA 176 GH24794-PA 1..67 120..186 142 41.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG30075-PA 195 CG30075-PA 1..195 1..195 1014 100 Plus
shu-PA 455 CG4735-PA 206..358 36..188 282 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18403-PA 446 GI18403-PA 203..350 34..181 271 35.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11067-PA 441 GL11067-PA 192..357 22..188 295 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18393-PA 441 GA18393-PA 192..357 22..188 280 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21539-PA 195 GM21539-PA 1..195 1..195 729 71.8 Plus
Dsec\GM15507-PA 453 GM15507-PA 204..356 36..188 303 39.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11049-PA 195 GD11049-PA 1..195 1..195 717 71.3 Plus
Dsim\GD25009-PA 453 GD25009-PA 204..356 36..188 301 39.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21483-PA 449 GJ21483-PA 209..349 41..181 260 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10287-PA 449 GK10287-PA 184..343 21..181 284 35.4 Plus
Dwil\GK15807-PA 455 GK15807-PA 204..349 36..181 271 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13584-PA 191 GE13584-PA 1..191 1..195 587 58.5 Plus
Dyak\GE11527-PA 453 GE11527-PA 189..358 20..190 292 35.1 Plus