Clone IP07204 Report

Search the DGRC for IP07204

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:72
Well:4
Vector:pOT2
Associated Gene/TranscriptCG31526-RA
Protein status:IP07204.pep: gold
Preliminary Size:586
Sequenced Size:604

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31526 2005-01-01 Successful iPCR screen
CG31526 2008-04-29 Release 5.5 accounting
CG31526 2008-08-15 Release 5.9 accounting
CG31526 2008-12-18 5.12 accounting

Clone Sequence Records

IP07204.complete Sequence

604 bp (604 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024369

> IP07204.complete
AAAATATGCAAAAGTAACGAACAGAACTTTACGTTACACGATTTGTGTGA
CAGTTGGCCAAGTAGAAGAATGAGGCGTTCCTAGCCAATTAGGCCAGATA
TTCTTCAGGGCACTTGTTGTGCATCTAAGCCGGCAGGGCAATTTCGCAGC
ATATTTTGGATAGTTCCCGCCACACCGCCTCACCTAACCACCTCCGAAAT
GCATCTTCCCTTAGCCTTTGGCACGGTATTCCATTTCCTGTTTGCTGCAT
CCCCGTGCACACAGTACGGTGCACGTTTGTGGTGCGAGGAGGAGCTGTCT
CCTTTTTCTGTTTGGAAATTGTTTTGCAAATTGCAAATTGCTAATGCAAA
ATGCCTGTGGCTCTTTCGGGCCACGATCGTAGTTATTTTGCCTAAACTTC
TCCTTAATTAACACTCCAAATTTGGCTGGCAGCTCTCCATTCACGACGAA
AGGCGCAGTGGGTATGTGCTGAATTAAATAACGAGCCGCACAATAAACGA
TTAACCTTTTAGATTTTAATTCTTAGGTTCTGTAATAATGTACTTTAGTA
TTTATTTTTCAAAATAAGAAAGCTTATTAAAAATTAAAAAAAAAAAAAAA
AAAA

IP07204.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31526-RA 770 CG31526-RA 182..770 1..589 2945 100 Plus
CG31526-RB 628 CG31526-RB 68..524 1..457 2285 100 Plus
CG31526.a 758 CG31526.a 318..758 149..589 2205 100 Plus
CG31526.a 758 CG31526.a 182..318 1..137 685 100 Plus
CG31526-RB 628 CG31526-RB 525..601 513..589 385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 359210..359658 137..585 2245 100 Plus
chr3R 27901430 chr3R 359013..359150 1..138 690 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4533492..4533944 137..589 2265 100 Plus
3R 32079331 3R 4533295..4533432 1..138 690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4274323..4274775 137..589 2265 100 Plus
3R 31820162 3R 4274126..4274263 1..138 690 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:38:19 has no hits.

IP07204.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:39:08 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 359013..359149 1..137 100 -> Plus
chr3R 359211..359658 138..585 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:58 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RB 1..213 199..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:30 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RC 1..213 199..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:59 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 1..213 199..411 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:13:44 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RB 1..213 199..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:53:33 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 1..213 199..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:23 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 68..652 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:29 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:59 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 48..632 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:13:44 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 68..652 1..585 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:53:33 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
CG31526-RA 48..632 1..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4533493..4533940 138..585 100   Plus
3R 4533295..4533431 1..137 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4533493..4533940 138..585 100   Plus
3R 4533295..4533431 1..137 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4533493..4533940 138..585 100   Plus
3R 4533295..4533431 1..137 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:59 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 359017..359153 1..137 100 -> Plus
arm_3R 359215..359662 138..585 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:07 Download gff for IP07204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4274324..4274771 138..585 100   Plus
3R 4274126..4274262 1..137 100 -> Plus

IP07204.hyp Sequence

Translation from 198 to 410

> IP07204.hyp
MHLPLAFGTVFHFLFAASPCTQYGARLWCEEELSPFSVWKLFCKLQIANA
KCLWLFRATIVVILPKLLLN*

IP07204.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31526-PC 70 CG31526-PC 1..70 1..70 381 100 Plus
CG31526-PA 70 CG31526-PA 1..70 1..70 381 100 Plus

IP07204.pep Sequence

Translation from 198 to 410

> IP07204.pep
MHLPLAFGTVFHFLFAASPCTQYGARLWCEEELSPFSVWKLFCKLQIANA
KCLWLFRATIVVILPKLLLN*
Sequence IP07204.pep has no blast hits.