IP07204.complete Sequence
604 bp (604 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024369
> IP07204.complete
AAAATATGCAAAAGTAACGAACAGAACTTTACGTTACACGATTTGTGTGA
CAGTTGGCCAAGTAGAAGAATGAGGCGTTCCTAGCCAATTAGGCCAGATA
TTCTTCAGGGCACTTGTTGTGCATCTAAGCCGGCAGGGCAATTTCGCAGC
ATATTTTGGATAGTTCCCGCCACACCGCCTCACCTAACCACCTCCGAAAT
GCATCTTCCCTTAGCCTTTGGCACGGTATTCCATTTCCTGTTTGCTGCAT
CCCCGTGCACACAGTACGGTGCACGTTTGTGGTGCGAGGAGGAGCTGTCT
CCTTTTTCTGTTTGGAAATTGTTTTGCAAATTGCAAATTGCTAATGCAAA
ATGCCTGTGGCTCTTTCGGGCCACGATCGTAGTTATTTTGCCTAAACTTC
TCCTTAATTAACACTCCAAATTTGGCTGGCAGCTCTCCATTCACGACGAA
AGGCGCAGTGGGTATGTGCTGAATTAAATAACGAGCCGCACAATAAACGA
TTAACCTTTTAGATTTTAATTCTTAGGTTCTGTAATAATGTACTTTAGTA
TTTATTTTTCAAAATAAGAAAGCTTATTAAAAATTAAAAAAAAAAAAAAA
AAAA
IP07204.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:43:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-RA | 770 | CG31526-RA | 182..770 | 1..589 | 2945 | 100 | Plus |
CG31526-RB | 628 | CG31526-RB | 68..524 | 1..457 | 2285 | 100 | Plus |
CG31526.a | 758 | CG31526.a | 318..758 | 149..589 | 2205 | 100 | Plus |
CG31526.a | 758 | CG31526.a | 182..318 | 1..137 | 685 | 100 | Plus |
CG31526-RB | 628 | CG31526-RB | 525..601 | 513..589 | 385 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:38:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 359210..359658 | 137..585 | 2245 | 100 | Plus |
chr3R | 27901430 | chr3R | 359013..359150 | 1..138 | 690 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:38:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4533492..4533944 | 137..589 | 2265 | 100 | Plus |
3R | 32079331 | 3R | 4533295..4533432 | 1..138 | 690 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 4274323..4274775 | 137..589 | 2265 | 100 | Plus |
3R | 31820162 | 3R | 4274126..4274263 | 1..138 | 690 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 23:38:19 has no hits.
IP07204.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:39:08 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 359013..359149 | 1..137 | 100 | -> | Plus |
chr3R | 359211..359658 | 138..585 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:58 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RB | 1..213 | 199..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:30 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RC | 1..213 | 199..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:59 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 1..213 | 199..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:13:44 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RB | 1..213 | 199..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:53:33 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 1..213 | 199..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:23 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 68..652 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:29 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 1..585 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:59 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 48..632 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:13:44 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 68..652 | 1..585 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:53:33 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 48..632 | 1..585 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533493..4533940 | 138..585 | 100 | | Plus |
3R | 4533295..4533431 | 1..137 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533493..4533940 | 138..585 | 100 | | Plus |
3R | 4533295..4533431 | 1..137 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:08 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533493..4533940 | 138..585 | 100 | | Plus |
3R | 4533295..4533431 | 1..137 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:59 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 359017..359153 | 1..137 | 100 | -> | Plus |
arm_3R | 359215..359662 | 138..585 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:07 Download gff for
IP07204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4274324..4274771 | 138..585 | 100 | | Plus |
3R | 4274126..4274262 | 1..137 | 100 | -> | Plus |
IP07204.hyp Sequence
Translation from 198 to 410
> IP07204.hyp
MHLPLAFGTVFHFLFAASPCTQYGARLWCEEELSPFSVWKLFCKLQIANA
KCLWLFRATIVVILPKLLLN*
IP07204.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:14:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-PC | 70 | CG31526-PC | 1..70 | 1..70 | 381 | 100 | Plus |
CG31526-PA | 70 | CG31526-PA | 1..70 | 1..70 | 381 | 100 | Plus |
IP07204.pep Sequence
Translation from 198 to 410
> IP07204.pep
MHLPLAFGTVFHFLFAASPCTQYGARLWCEEELSPFSVWKLFCKLQIANA
KCLWLFRATIVVILPKLLLN*
Sequence IP07204.pep has no blast hits.