Clone IP07214 Report

Search the DGRC for IP07214

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:72
Well:14
Vector:pOT2
Associated Gene/TranscriptCG31861-RA
Protein status:IP07214.pep: gold
Preliminary Size:608
Sequenced Size:752

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31861 2005-01-01 Successful iPCR screen

Clone Sequence Records

IP07214.complete Sequence

752 bp (752 high quality bases) assembled on 2006-09-20

GenBank Submission: BT029062

> IP07214.complete
CCACTCCCCGGAACATATACATTCCACGAAATCCTGAGTCGCTTCGGTGG
ACAACTGAACTACGGAAGCAGCCGATTGTAGAGCACTTATAAGGATCAAC
TTTGGTGAAACTTTGAAAGTCATTTAGTTGGCAGAAAATGGGAAAGTCTA
CTGGATCGTCGTTTAAGCCCGTCAAGCGTCTCAATAGAAAAATTAAAGAA
CCTGTTTCTCCAAAACTATCTGCCAACCAAAATGTTACTCCCACCAGGCG
GATTAAACGAATCAATACTCCGGTGGCTGTCGATCCAAGTCCAAGTCCAT
CGGTGGTGGCGCGTCGAGCTCGTACCAGTGCGGCATTAAAGAGTTTTATT
AACAAATACAGGAGAGAACATCCTGGAAAGCTGCGCGCTGAGGTCGTCTC
CATTTGGCGCAAAATGAGCGTCGAAGAAAAGCAAGCCTTTCAAAGAATCG
GCACAATTCAAGAAACTCCAACACACGTGCATTTTGAGGAGGAGGAAGTT
CCTGTACCCATTTCCAATGATGTTATAGATATAGTTGAAGTTAGCCCACC
GATACCGGAGAGAAACCCCTCGATTTTTAGATATTTTTTAAATGCGATTA
ATAGGGCCTTGCATATGTTTTACTAAATACTGATTGCTTTCCAAATTGCA
TTTGTAAGAAGTCACAAAAGTTACTAATTCAAGATGAATAAGTAAATATT
GTACGAAATAAATGTTTGGCCGCTTGCTCTGATTTTAAAAAAAAAAAAAA
AA

IP07214.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 17:15:41 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12160529..12161254 11..736 3615 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12161880..12162607 11..738 3640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12161880..12162607 11..738 3640 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:36:45 has no hits.

IP07214.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:37:46 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12160523..12161254 5..736 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:26:45 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 1..489 138..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:48 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 1..489 138..626 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:46:56 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:51 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 1..489 138..626 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:26:45 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 1..736 1..736 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:48 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 1..736 1..736 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:46:56 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
Dscam-RA 352..370 584..602 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:51 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31861-RA 29..764 1..736 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:46 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12161874..12162605 5..736 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:46 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12161874..12162605 5..736 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:46 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12161874..12162605 5..736 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:48 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12161874..12162605 5..736 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:31 Download gff for IP07214.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12161874..12162605 5..736 99   Plus

IP07214.hyp Sequence

Translation from 137 to 625

> IP07214.hyp
MGKSTGSSFKPVKRLNRKIKEPVSPKLSANQNVTPTRRIKRINTPVAVDP
SPSPSVVARRARTSAALKSFINKYRREHPGKLRAEVVSIWRKMSVEEKQA
FQRIGTIQETPTHVHFEEEEVPVPISNDVIDIVEVSPPIPERNPSIFRYF
LNAINRALHMFY*

IP07214.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31861-PA 162 CG31861-PA 1..162 1..162 829 100 Plus

IP07214.pep Sequence

Translation from 137 to 625

> IP07214.pep
MGKSTGSSFKPVKRLNRKIKEPVSPKLSANQNVTPTRRIKRINTPVAVDP
SPSPSVVARRARTSAALKSFINKYRREHPGKLRAEVVSIWRKMSVEEKQA
FQRIGTIQETPTHVHFEEEEVPVPISNDVIDIVEVSPPIPERNPSIFRYF
LNAINRALHMFY*

IP07214.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31861-PA 162 CG31861-PA 1..162 1..162 829 100 Plus