Clone IP07252 Report

Search the DGRC for IP07252

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:72
Well:52
Vector:pOT2
Associated Gene/TranscriptCG4438-RA
Protein status:IP07252.pep: gold
Preliminary Size:588
Sequenced Size:839

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4438 2005-01-01 Successful iPCR screen
CG4438 2008-04-29 Release 5.5 accounting
CG4438 2008-08-15 Release 5.9 accounting
CG4438 2008-12-18 5.12 accounting

Clone Sequence Records

IP07252.complete Sequence

839 bp (839 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024370

> IP07252.complete
AAGACAACAAAGTGTGTTTGAGCAGCTATTGAAATTTTGTTTTCACGCAG
AAATTATCACATTTCTATCAGATTTTCTACGGCTCTTTGCAGTTGTGCTA
ATAGTTGTTTAAGCAACGTGATATTAAAAAGTTTATCTAAAAGGCATAAA
CAAACCGTACATAGAAAACCGATAGGATCATCATGCCACGAGGAAAGTTC
CTTAGCTACAAGGGTCGCACTCGCCAGTTCACATCCCCCGAGGAACTGCG
GCAGGAGTCAGAGGACGATTACGACCAAGTCAGCGGCTCTGGTTCAGATA
GCGATGAGAAAGTAGCAACCAGGGGAGGAGCCAATTCATCCTCCTCCATA
GCAAAGGATCGCACCTTGAAAAAAGCGACTCGCAATCAGAAATCGTCGTC
AGATGAGGTGGACAGTTCTTCCGAGGATTGCGAAACGGAATCTCGTGTTG
CCAGAAAGGGCGTGGCTTCACTCATTGAAATCGATAATCCCAACCGGGTG
TCCAAGAAGGGGCCACAAAAGATTTCAGCCATTATGCTTGATCAGACCAA
GGCGGGGCTATCCCGCCGCGATCAAGATCAGAGTGCTCGCAAGCGTTACG
AGAAACTCCATGTAGCTGGGAAAACCACCGAGGCTAGGGCCGACTTGGCC
AGGCTGGCTCTGATCCGGAAGCAGCGCGAAGAAACCGCTGCTAGGCGTGA
AGCGGAGAAGAAAGCAGCCAATGTGGTCACCAAGAAGCCGTTTGCCAAGT
AGAGAATCCATCTCTTAAAGCATCCATTCCCCAAACGGGAATGAATAAAT
AAATAAAAAAAATGTTAAGAAAAAAAAAAAAAAAAAAAA

IP07252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4438-RA 984 CG4438-RA 55..876 1..822 4110 100 Plus
CG11444-RA 1229 CG11444-RA 838..1025 579..766 475 83.5 Plus
CG11444-RA 1229 CG11444-RA 358..493 177..312 350 83.8 Plus
CG11444-RA 1229 CG11444-RA 654..755 431..532 255 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9396047..9396709 819..157 3315 100 Minus
chr2L 23010047 chr2L 9396767..9396925 159..1 780 99.4 Minus
chrX 22417052 chrX 4446221..4446408 766..579 475 83.5 Minus
chrX 22417052 chrX 4446753..4446888 312..177 350 83.8 Minus
chrX 22417052 chrX 4446491..4446592 532..431 255 83.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9397107..9397772 822..157 3330 100 Minus
2L 23513712 2L 9397830..9397988 159..1 795 100 Minus
X 23542271 X 4553321..4553508 766..579 475 83.5 Minus
X 23542271 X 4553853..4553988 312..177 350 83.8 Minus
X 23542271 X 4553591..4553692 532..431 255 83.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9397107..9397772 822..157 3330 100 Minus
2L 23513712 2L 9397830..9397988 159..1 795 100 Minus
X 23527363 X 4561419..4561606 766..579 475 83.5 Minus
X 23527363 X 4561951..4562086 312..177 350 83.8 Minus
X 23527363 X 4561689..4561790 532..431 255 83.3 Minus
Blast to na_te.dros performed on 2019-03-15 12:10:16 has no hits.

IP07252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:11:24 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9396070..9396709 157..796 100 <- Minus
chr2L 9396770..9396925 1..156 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:03 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..570 183..752 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:29 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RB 1..570 183..752 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:38:13 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..570 183..752 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:39 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..570 183..752 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:52:58 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..570 183..752 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:46 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:29 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:38:13 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:39 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..588 165..752 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:52:58 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
CG4438-RA 1..796 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:24 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9397133..9397772 157..796 100 <- Minus
2L 9397833..9397988 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:24 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9397133..9397772 157..796 100 <- Minus
2L 9397833..9397988 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:11:24 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9397133..9397772 157..796 100 <- Minus
2L 9397833..9397988 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:38:13 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9397133..9397772 157..796 100 <- Minus
arm_2L 9397833..9397988 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:31 Download gff for IP07252.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9397833..9397988 1..156 100   Minus
2L 9397133..9397772 157..796 100 <- Minus

IP07252.pep Sequence

Translation from 182 to 751

> IP07252.pep
MPRGKFLSYKGRTRQFTSPEELRQESEDDYDQVSGSGSDSDEKVATRGGA
NSSSSIAKDRTLKKATRNQKSSSDEVDSSSEDCETESRVARKGVASLIEI
DNPNRVSKKGPQKISAIMLDQTKAGLSRRDQDQSARKRYEKLHVAGKTTE
ARADLARLALIRKQREETAARREAEKKAANVVTKKPFAK*

IP07252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19530-PA 164 GF19530-PA 1..142 1..163 324 47.9 Plus
Dana\GF21169-PA 210 GF21169-PA 1..210 1..189 305 50.5 Plus
Dana\GF18397-PA 187 GF18397-PA 1..158 1..164 271 44.8 Plus
Dana\GF21454-PA 196 GF21454-PA 1..137 1..163 195 37.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24029-PA 286 GG24029-PA 91..286 1..189 662 74 Plus
Dere\GG18534-PA 215 GG18534-PA 1..215 1..189 426 60.5 Plus
Dere\GG12786-PA 190 GG12786-PA 1..136 1..172 154 32 Plus
Dere\GG12788-PA 389 GG12788-PA 1..136 1..172 154 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17583-PA 234 GH17583-PA 1..234 1..189 274 44.9 Plus
Dgri\GH11454-PA 228 GH11454-PA 1..205 1..187 231 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG4438-PB 189 CG4438-PB 1..189 1..189 932 100 Plus
CG4438-PA 189 CG4438-PA 1..189 1..189 932 100 Plus
CG11444-PB 215 CG11444-PB 1..215 1..189 573 62.3 Plus
CG11444-PA 215 CG11444-PA 1..215 1..189 573 62.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15182-PA 219 GI15182-PA 1..219 1..189 370 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13320-PA 214 GL13320-PA 1..214 1..189 296 51.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11007-PA 214 GA11007-PA 1..214 1..189 296 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12473-PA 208 GM12473-PA 18..208 1..189 704 85 Plus
Dsec\GM12684-PA 214 GM12684-PA 1..214 1..189 428 61.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22357-PA 191 GD22357-PA 1..191 1..189 708 85 Plus
Dsim\GD16291-PA 214 GD16291-PA 1..214 1..189 431 62.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17062-PA 225 GJ17062-PA 1..225 1..189 304 44.9 Plus
Dvir\GJ15648-PA 230 GJ15648-PA 1..168 1..180 165 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17879-PA 208 GK17879-PA 1..185 1..164 309 48.6 Plus
Dwil\GK15029-PA 181 GK15029-PA 1..158 1..164 293 40.8 Plus
Dwil\GK15983-PA 270 GK15983-PA 1..174 1..179 151 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10533-PA 196 GE10533-PA 1..196 1..189 671 74 Plus
Dyak\GE16850-PA 215 GE16850-PA 1..215 1..189 429 60.9 Plus

IP07252.hyp Sequence

Translation from 182 to 751

> IP07252.hyp
MPRGKFLSYKGRTRQFTSPEELRQESEDDYDQVSGSGSDSDEKVATRGGA
NSSSSIAKDRTLKKATRNQKSSSDEVDSSSEDCETESRVARKGVASLIEI
DNPNRVSKKGPQKISAIMLDQTKAGLSRRDQDQSARKRYEKLHVAGKTTE
ARADLARLALIRKQREETAARREAEKKAANVVTKKPFAK*

IP07252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4438-PB 189 CG4438-PB 1..189 1..189 932 100 Plus
CG4438-PA 189 CG4438-PA 1..189 1..189 932 100 Plus
CG11444-PB 215 CG11444-PB 1..215 1..189 573 62.3 Plus
CG11444-PA 215 CG11444-PA 1..215 1..189 573 62.3 Plus