Clone IP07261 Report

Search the DGRC for IP07261

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:72
Well:61
Vector:pOT2
Associated Gene/TranscriptCG6308-RA
Protein status:IP07261.pep: gold
Preliminary Size:576
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6308 2005-01-01 Successful iPCR screen
CG6308 2008-04-29 Release 5.5 accounting
CG6308 2008-08-15 Release 5.9 accounting
CG6308 2008-12-18 5.12 accounting

Clone Sequence Records

IP07261.complete Sequence

664 bp (664 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024367

> IP07261.complete
TCATTTAAATTGAGTTTTCGAAGGGCAAGATGACGACCAGCTCGCCTCAC
CCCACCTACGTAATACTGGGCTCTGGCGGCCACACGGCGGAGATGTGCCG
GCTGACCCAGGCGCTGCTGCAACAGACAGACATCGAACAGACGGAGAAGT
ACCAGCCAATTAGACTGATCCTGGCCAACAGTGACTCTACCTCCGAGCGC
CAGTTCAGGCAGGTCCTGCCGCAGGCTGCCCAGAGGGCGGAATTCGTGAA
GGTGCCGCGCAGCCGCGACGTGGGCCAATCCTGGCTAAGCAGCATCTTCA
CCAGCCTGTGGGCGCTTCTCTGGAGCTGCTATCTGGTCTGGCGTGATCGC
CCCCAACTGATCCTCTGCAATGGACCCGGCACCTGTGTGCCCTTCTGCTA
TGCCGCCTATCTGTGGCGCCTCCTCGGACGCCTGCCCTCGCACTCCAGAA
TAGTGTTCGTGGAGAGCTTCTGCCGCGTGGAGACGCTGTCGCTGAGCGGA
CGCCTGCTCCTTCCGCTGGCGGACCTCTTTGTGGTCCACTGGCCGGCGTT
GGCCACGCGCTATTTGGATAAAAAGAATGTGCGATATTTTGGGCGAATCC
TGTAACATGTTTTTAATAACATTAAAGTTAACATTAGTTTCTATTTAAAA
AAAAAAAAAAAAAA

IP07261.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6308-RA 696 CG6308-RA 51..696 1..646 3215 99.8 Plus
CG9203-RA 2382 CG9203-RA 2325..2382 648..591 290 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15362162..15362807 1..646 3215 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15472214..15472861 1..648 3225 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15480312..15480959 1..648 3225 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 15:33:22 has no hits.

IP07261.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:34:14 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15362162..15362807 1..646 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:07 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:01 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:48:22 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:38 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:04 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:26 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:00 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 51..696 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:48:22 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 51..696 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:38 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:04 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
CG6308-RA 51..696 1..646 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:14 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
X 15472214..15472859 1..646 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:14 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
X 15472214..15472859 1..646 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:14 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
X 15472214..15472859 1..646 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:48:22 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15366247..15366892 1..646 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:35 Download gff for IP07261.complete
Subject Subject Range Query Range Percent Splice Strand
X 15480312..15480957 1..646 99   Plus

IP07261.pep Sequence

Translation from 29 to 604

> IP07261.pep
MTTSSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILAN
SDSTSERQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSC
YLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRV
ETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL*

IP07261.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21906-PA 184 GF21906-PA 2..184 9..191 749 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17884-PA 191 GG17884-PA 1..191 1..191 943 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12321-PA 197 GH12321-PA 9..197 2..191 791 73.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Alg14-PA 191 CG6308-PA 1..191 1..191 1011 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21466-PA 189 GI21466-PA 4..189 2..191 769 73.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13417-PA 188 GL13417-PA 3..188 2..191 714 68.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19504-PA 188 GA19504-PA 3..188 2..191 714 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19574-PA 191 GM19574-PA 1..191 1..191 967 94.8 Plus
Dsec\GM19571-PA 192 GM19571-PA 1..192 1..191 726 71.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24820-PA 61 GD24820-PA 1..61 131..191 308 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16486-PA 195 GJ16486-PA 11..195 4..191 741 72.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25441-PA 169 GK25441-PA 1..169 22..191 655 68.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17190-PA 191 GE17190-PA 1..191 1..191 956 93.7 Plus

IP07261.hyp Sequence

Translation from 29 to 604

> IP07261.hyp
MTTSSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILAN
SDSTSERQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSC
YLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRV
ETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL*

IP07261.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6308-PA 191 CG6308-PA 1..191 1..191 1011 100 Plus