BDGP Sequence Production Resources |
Search the DGRC for IP07261
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 72 |
Well: | 61 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6308-RA |
Protein status: | IP07261.pep: gold |
Preliminary Size: | 576 |
Sequenced Size: | 664 |
Gene | Date | Evidence |
---|---|---|
CG6308 | 2005-01-01 | Successful iPCR screen |
CG6308 | 2008-04-29 | Release 5.5 accounting |
CG6308 | 2008-08-15 | Release 5.9 accounting |
CG6308 | 2008-12-18 | 5.12 accounting |
664 bp (664 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024367
> IP07261.complete TCATTTAAATTGAGTTTTCGAAGGGCAAGATGACGACCAGCTCGCCTCAC CCCACCTACGTAATACTGGGCTCTGGCGGCCACACGGCGGAGATGTGCCG GCTGACCCAGGCGCTGCTGCAACAGACAGACATCGAACAGACGGAGAAGT ACCAGCCAATTAGACTGATCCTGGCCAACAGTGACTCTACCTCCGAGCGC CAGTTCAGGCAGGTCCTGCCGCAGGCTGCCCAGAGGGCGGAATTCGTGAA GGTGCCGCGCAGCCGCGACGTGGGCCAATCCTGGCTAAGCAGCATCTTCA CCAGCCTGTGGGCGCTTCTCTGGAGCTGCTATCTGGTCTGGCGTGATCGC CCCCAACTGATCCTCTGCAATGGACCCGGCACCTGTGTGCCCTTCTGCTA TGCCGCCTATCTGTGGCGCCTCCTCGGACGCCTGCCCTCGCACTCCAGAA TAGTGTTCGTGGAGAGCTTCTGCCGCGTGGAGACGCTGTCGCTGAGCGGA CGCCTGCTCCTTCCGCTGGCGGACCTCTTTGTGGTCCACTGGCCGGCGTT GGCCACGCGCTATTTGGATAAAAAGAATGTGCGATATTTTGGGCGAATCC TGTAACATGTTTTTAATAACATTAAAGTTAACATTAGTTTCTATTTAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 15362162..15362807 | 1..646 | 3215 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 15472214..15472861 | 1..648 | 3225 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 15480312..15480959 | 1..648 | 3225 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 15362162..15362807 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 51..696 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 51..696 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6308-RA | 51..696 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15472214..15472859 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15472214..15472859 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15472214..15472859 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 15366247..15366892 | 1..646 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15480312..15480957 | 1..646 | 99 | Plus |
Translation from 29 to 604
> IP07261.pep MTTSSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILAN SDSTSERQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSC YLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRV ETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21906-PA | 184 | GF21906-PA | 2..184 | 9..191 | 749 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17884-PA | 191 | GG17884-PA | 1..191 | 1..191 | 943 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12321-PA | 197 | GH12321-PA | 9..197 | 2..191 | 791 | 73.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Alg14-PA | 191 | CG6308-PA | 1..191 | 1..191 | 1011 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21466-PA | 189 | GI21466-PA | 4..189 | 2..191 | 769 | 73.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13417-PA | 188 | GL13417-PA | 3..188 | 2..191 | 714 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19504-PA | 188 | GA19504-PA | 3..188 | 2..191 | 714 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19574-PA | 191 | GM19574-PA | 1..191 | 1..191 | 967 | 94.8 | Plus |
Dsec\GM19571-PA | 192 | GM19571-PA | 1..192 | 1..191 | 726 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24820-PA | 61 | GD24820-PA | 1..61 | 131..191 | 308 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16486-PA | 195 | GJ16486-PA | 11..195 | 4..191 | 741 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25441-PA | 169 | GK25441-PA | 1..169 | 22..191 | 655 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17190-PA | 191 | GE17190-PA | 1..191 | 1..191 | 956 | 93.7 | Plus |
Translation from 29 to 604
> IP07261.hyp MTTSSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILAN SDSTSERQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSC YLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRV ETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6308-PA | 191 | CG6308-PA | 1..191 | 1..191 | 1011 | 100 | Plus |