Clone IP07275 Report

Search the DGRC for IP07275

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:72
Well:75
Vector:pOT2
Associated Gene/TranscriptPsf1-RA
Protein status:IP07275.pep: gold
Preliminary Size:609
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9187 2005-01-01 Successful iPCR screen
Psf1 2008-04-29 Release 5.5 accounting
Psf1 2008-08-15 Release 5.9 accounting
Psf1 2008-12-18 5.12 accounting

Clone Sequence Records

IP07275.complete Sequence

711 bp (711 high quality bases) assembled on 2006-03-22

GenBank Submission: BT025002

> IP07275.complete
ACAATGAGCCGACAAACAAAAATGTTCGGGGAGAAAGCCTTCGACCTGCT
TAAAGAACTGGAGAGATCGTCTCAGACAATTCCCGCCTTCGACGACGATG
GGGTGCGCCAGGTGCTGGAGGAGATCAAGGCGATATTCGAGGAGAACGTG
GCCCAGGCCTCCAGCTACAATGCTTCCGGGGATCGCAGTCTGTGGCCCCT
GCTCAACTTCAGGCACGCAGCTCTCCAGAGGAACAAGCGGTGCCTGCTGG
CCTACCTATACGAGCGGTGCAGGAGGATCAAGGCCCTCAGGTGGGAGTTT
GGACCCATTATCCCCGGGGACATCAAGCAGGCACTCTGCGAACCGGAGGT
CACCTTCTTCAACAACTACTCCAAGTCCCTGGCTGCCTACATGTGCAGTG
CGGGCTACAACCAGGGCTTGCCCATTGATCTAACCAACAATCTGCGTCCG
CCCAAGTCACTTTACATCGAGGTGCGCTGCATGGAGGACTATGGGAAGTT
CGAGCTGGACGACGGCGAGGTGATCCACCTGAAGAAGAACAGCCAGCACT
ATCTGCCCCGAGCTCAGGTGGAGTCTCTCGTGAGGCAGGGCATTCTTCAC
CACATAGCCTAGTCGGGATTATTTGATAATAAGAGTTTACTATACATATT
TAATGGTTTAATGTAGAACAAATAAAAGATAAAAAATTATTTAAAAAAAA
AAAAAAAAAAA

IP07275.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Psf1-RA 692 Psf1-RA 1..692 1..692 3400 99.4 Plus
CG32318-RA 495 CG32318-RA 318..495 435..612 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1246501..1247192 692..1 3445 99.9 Minus
chr3L 24539361 chr3L 1245508..1245765 692..435 1290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1246984..1247677 694..1 3410 99.4 Minus
3L 28110227 3L 1245991..1246250 694..435 1300 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1246984..1247677 694..1 3410 99.4 Minus
3L 28103327 3L 1245991..1246250 694..435 1300 100 Minus
Blast to na_te.dros performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3445..3514 622..691 116 62.9 Plus

IP07275.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:50:24 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1246524..1247192 1..669 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:10 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:05:43 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:54 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:50:47 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:08:22 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:54:00 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:05:42 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 474..1165 1..692 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:54 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..692 1..692 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:50:47 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..609 4..612 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:08:22 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
Psf1-RA 1..692 1..692 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:24 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246986..1247677 1..692 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:24 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246986..1247677 1..692 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:50:24 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246986..1247677 1..692 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:54 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1246986..1247677 1..692 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:25:33 Download gff for IP07275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246986..1247677 1..692 99   Minus

IP07275.hyp Sequence

Translation from 0 to 611

> IP07275.hyp
TMSRQTKMFGEKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENV
AQASSYNASGDRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEF
GPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRP
PKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILH
HIA*

IP07275.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Psf1-PA 202 CG9187-PA 1..202 2..203 1060 100 Plus
CG32318-PA 164 CG32318-PA 107..164 146..203 308 100 Plus

IP07275.pep Sequence

Translation from 3 to 611

> IP07275.pep
MSRQTKMFGEKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVA
QASSYNASGDRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFG
PIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRPP
KSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHH
IA*

IP07275.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25042-PA 204 GF25042-PA 1..204 1..202 997 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14612-PA 202 GG14612-PA 1..202 1..202 1066 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15736-PA 200 GH15736-PA 1..200 1..202 905 85.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Psf1-PA 202 CG9187-PA 1..202 1..202 1060 100 Plus
CG32318-PA 164 CG32318-PA 107..164 145..202 308 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12793-PA 200 GI12793-PA 1..200 1..202 912 84.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16122-PA 202 GL16122-PA 1..202 1..202 991 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28390-PA 202 GA28390-PA 1..202 1..202 991 91.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14226-PA 196 GM14226-PA 1..196 7..202 1049 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13488-PA 196 GD13488-PA 1..196 7..202 1054 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16092-PA 200 GJ16092-PA 1..200 1..202 926 85.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16541-PA 191 GK16541-PA 1..191 7..202 876 85.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20973-PA 196 GE20973-PA 1..196 7..202 1049 99 Plus