Clone IP07325 Report

Search the DGRC for IP07325

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:73
Well:25
Vector:pOT2
Associated Gene/TranscriptCG42299-RA
Protein status:IP07325.pep: gold
Preliminary Size:549
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32584 2005-01-01 Successful iPCR screen
CG32584 2008-04-29 Release 5.5 accounting
CG42299 2008-08-15 Release 5.9 accounting
CG42299 2008-12-18 5.12 accounting

Clone Sequence Records

IP07325.complete Sequence

698 bp (698 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022759

> IP07325.complete
AAAGCGTCTGAATAAAATTTATGATCAAAATGGACCCGAAATCCCACCAA
AAGCTCTTCAGGGAAATGGCAGAAGTCGTGTCCAATTCCAGCGATGACGG
GGAGAAGTTGCTAACCAAAAACTCTAGCAACACCATCGAGAAGTCCGAGG
AAGTCTGCAAGGAGCGCCCCGAAGCTGTGGAGCAGATGCGCATCGATGTC
AATAACTCACTTGAGGACACGAACTACATGAATGCGGTGGAATCAGAAGC
TCAAAAGAATATCGCCGGCCTTGATGAGGACCTTATCATGGAAGACTTCG
GCGTCGAGGTCGTCCCGTTCCACGATCCCTGGTCCAAGCTCCTGATAAAG
CACCCCGTGCGCAACAAAAGGTGCGGTCATATCTACGACCGCGAAACGGT
TTTAATGATCATCAAGGACAACATTGGCATCCTATGCCCGGTGCGCGACT
GTCCCAACTTGTCCGACATCAAGTTAGAGCACCTGGTCAAGGACCCCGAC
GTGGAGCAGGAGTTGCAAAAGCGCAAGTCCGACAAGATCAAGAATGAAAC
TTCCTCGGATGAGGACTAAGAACAGGCAGGTCATTAATTATATATAAAAA
GCGCCTTTAAACTTTAGATTTTAATATGACTTCAAGTCTTGTTGAGAATT
AACTTTATAAATAAAAAACACTCCTTTGGAAAAAAAAAAAAAAAAAAA

IP07325.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42299-RA 712 CG42299-RA 34..712 1..679 3395 100 Plus
CG42300-RA 677 CG42300-RA 59..677 1..622 2935 98.3 Plus
cerv-RA 1076 cerv-RA 579..913 257..591 805 82.6 Plus
cerv-RA 1076 cerv-RA 419..541 115..237 390 87.8 Plus
cerv-RA 1076 cerv-RA 266..325 46..105 180 86.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15464865..15465470 679..74 3030 100 Minus
chrX 22417052 chrX 15445207..15445809 679..74 2875 98.7 Minus
chrX 22417052 chrX 15467035..15467529 591..115 970 80.2 Minus
chr3L 24539361 chr3L 17469278..17469572 272..566 605 80.3 Plus
chrX 22417052 chrX 15465527..15465601 75..1 375 100 Minus
chrX 22417052 chrX 15445875..15445949 75..1 345 97.3 Minus
chr3L 24539361 chr3L 17469095..17469181 116..202 270 87.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15574945..15575552 681..74 3040 100 Minus
X 23542271 X 15555251..15555855 681..74 2885 98.7 Minus
X 23542271 X 15577148..15577642 591..115 970 80.2 Minus
3L 28110227 3L 17479760..17480054 272..566 605 80.3 Plus
X 23542271 X 15575609..15575683 75..1 375 100 Minus
X 23542271 X 15555921..15555995 75..1 345 97.3 Minus
3L 28110227 3L 17479577..17479712 116..251 275 80.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15583043..15583650 681..74 3040 100 Minus
X 23527363 X 15563349..15563953 681..74 2895 98.6 Minus
X 23527363 X 15585246..15585580 591..257 805 82.6 Minus
3L 28103327 3L 17472860..17473154 272..566 605 80.3 Plus
X 23527363 X 15585618..15585740 237..115 390 87.8 Minus
X 23527363 X 15583707..15583781 75..1 375 100 Minus
X 23527363 X 15564019..15564093 75..1 345 97.3 Minus
3L 28103327 3L 17472677..17472812 116..251 275 80.1 Plus
Blast to na_te.dros performed on 2019-03-16 23:42:17 has no hits.

IP07325.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:42:58 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15464865..15465468 76..679 100 <- Minus
chrX 15465527..15465601 1..75 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:15 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..549 21..569 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:11 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..549 21..569 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:08 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..549 21..569 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:10 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..549 21..569 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:25 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..549 21..569 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:09 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 1..679 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:11 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 1..679 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:08 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 1..679 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:10 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 1..679 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:25 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 1..679 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:58 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
X 15574947..15575550 76..679 100 <- Minus
X 15575609..15575683 1..75 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:58 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
X 15574947..15575550 76..679 100 <- Minus
X 15575609..15575683 1..75 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:58 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
X 15574947..15575550 76..679 100 <- Minus
X 15575609..15575683 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:08 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15468980..15469583 76..679 100 <- Minus
arm_X 15469642..15469716 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:13 Download gff for IP07325.complete
Subject Subject Range Query Range Percent Splice Strand
X 15583045..15583648 76..679 100 <- Minus
X 15583707..15583781 1..75 100   Minus

IP07325.hyp Sequence

Translation from 20 to 568

> IP07325.hyp
MIKMDPKSHQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERP
EAVEQMRIDVNNSLEDTNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPF
HDPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDI
KLEHLVKDPDVEQELQKRKSDKIKNETSSDED*

IP07325.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42299-PA 182 CG32584-PA 1..182 1..182 945 100 Plus
CG42300-PA 181 CG42300-PA 1..181 1..182 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..224 9..182 496 54.8 Plus
cerv-PA 230 CG15645-PA 17..224 9..182 496 54.8 Plus
cerv-PC 177 CG15645-PC 16..171 33..182 472 62.8 Plus

IP07325.pep Sequence

Translation from 20 to 568

> IP07325.pep
MIKMDPKSHQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERP
EAVEQMRIDVNNSLEDTNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPF
HDPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDI
KLEHLVKDPDVEQELQKRKSDKIKNETSSDED*

IP07325.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22252-PA 248 GF22252-PA 86..222 47..168 207 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\cerv-PA 241 GG19392-PA 19..231 11..179 370 41.3 Plus
Dere\GG11876-PA 240 GG11876-PA 19..230 11..179 362 41 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22621-PA 226 GH22621-PA 73..225 34..182 229 32.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42299-PA 182 CG32584-PA 1..182 1..182 945 100 Plus
CG42300-PA 181 CG42300-PA 1..181 1..182 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..224 9..182 496 54.8 Plus
cerv-PA 230 CG15645-PA 17..224 9..182 496 54.8 Plus
cerv-PC 177 CG15645-PC 16..171 33..182 472 62.8 Plus
qjt-PB 233 CG13732-PB 17..231 9..182 422 46.5 Plus
qjt-PA 233 CG13732-PA 17..231 9..182 422 46.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15639-PA 226 GI15639-PA 73..224 34..182 206 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25912-PA 232 GL25912-PA 19..218 11..172 216 30 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25188-PA 232 GA25188-PA 19..218 11..172 210 30 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22549-PA 232 GM22549-PA 18..218 10..173 449 50.2 Plus
Dsec\GM22550-PA 200 GM22550-PA 36..186 32..173 429 58.3 Plus
Dsec\qjt-PA 233 GM25704-PA 17..231 9..182 416 45.1 Plus
Dsec\GM22546-PA 98 GM22546-PA 1..84 90..173 281 61.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\cerv-PA 232 GD15792-PA 18..223 10..178 467 51 Plus
Dsim\qjt-PA 233 GD14711-PA 17..231 9..182 413 44.7 Plus
Dsim\GD15796-PA 196 GD15796-PA 18..120 10..84 146 39.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19226-PA 225 GJ19226-PA 136..222 94..180 194 46 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19230-PA 226 GK19230-PA 61..212 20..168 195 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\cerv-PA 238 GE16038-PA 19..234 11..182 424 45.4 Plus
Dyak\GE26335-PA 238 GE26335-PA 19..234 11..182 405 44 Plus