Clone IP07356 Report

Search the DGRC for IP07356

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:73
Well:56
Vector:pOT2
Associated Gene/TranscriptCG5139-RA
Protein status:IP07356.pep: gold
Preliminary Size:591
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5139 2005-01-01 Successful iPCR screen
CG5139 2008-04-29 Release 5.5 accounting
CG5139 2008-08-15 Release 5.9 accounting
CG5139 2008-12-18 5.12 accounting

Clone Sequence Records

IP07356.complete Sequence

800 bp (800 high quality bases) assembled on 2006-04-13

GenBank Submission: BT025132

> IP07356.complete
TGGGAGGAGTGTGCATTCTTGTATTCAAATTTTTTATTGTATAAAATTTT
CTCGTGAACAAATTATGGAAAAGAATCTGTGGAATACGCTGCAGGAAGTC
GAGCAAGTCGAGGTTGCTTTTAAGCAGACCTTGAGAAACATTACCGATAT
CCAGAACCGATACAAAACGGTTTCGGCCTTGAAGAGCAAGGCCTCCAGGC
GCCAGGAATCCTTCGAGGCGGAGATCCAAGGTGCCATTACAGCACCCAAT
CCTGCCAAGAAAAGGAGGGTGGTCAAGAAGAGCAAGATCAATATCTTGAA
ACAGAGGAGTCTGCTACCAATGCCAGTACCCAATCTCAGATCGGAAACTA
TCCTGCAGGTGGAGGAGCCTTTTGTGTGTCTCGAAACGAATTGCGTCTAC
GAAATACACAAGACAACCACTCACCTGATGGCGCGGAAACCATATGGAGC
TCTCATCCGGCGACTGTATCGGTCAGCCAGGCGGAAGAGGATGTACGACC
AGGAGCAGGAACAGGATCAGGAACAGGTTGAGGAACAGGATCTGTATCCA
GACATGGAATGTTACCACTGCTGCTGCTCAGCGTGTTGCATAGAGTGCAG
ATAAATTTGTTCGTGATTGTATATAGCATATTTTTGGGCTTTCACAAAGC
TTCAAAGTTTGTAGCAAGCATTTTATGTGATAATAAATAAATTGTACTTG
TCCAAATGAACAGCAACAGCTATTTGCTGGCTAGTAACAAAAAAAAAAAA
AAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP07356.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5139-RA 735 CG5139-RA 1..735 1..735 3675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1198412..1199151 740..1 3610 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1198463..1199202 740..1 3700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1198463..1199202 740..1 3700 100 Minus
Blast to na_te.dros performed 2019-03-15 14:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2508..2577 80..7 118 64.9 Minus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 3425..3504 415..341 107 66.2 Minus

IP07356.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:48:46 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1198414..1199151 1..738 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:18 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..540 65..604 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:25 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..540 65..604 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:42:24 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..540 65..604 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:09 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..540 65..604 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:53 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..540 65..604 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:54 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..591 14..604 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:24 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 3..740 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:42:24 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 3..740 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:09 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 1..591 14..604 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:53 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
CG5139-RA 65..802 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:46 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1198465..1199202 1..738 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:46 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1198465..1199202 1..738 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:46 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1198465..1199202 1..738 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:42:24 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1198465..1199202 1..738 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:35 Download gff for IP07356.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1198465..1199202 1..738 100   Minus

IP07356.hyp Sequence

Translation from 0 to 603

> IP07356.hyp
GRSVHSCIQIFYCIKFSREQIMEKNLWNTLQEVEQVEVAFKQTLRNITDI
QNRYKTVSALKSKASRRQESFEAEIQGAITAPNPAKKRRVVKKSKINILK
QRSLLPMPVPNLRSETILQVEEPFVCLETNCVYEIHKTTTHLMARKPYGA
LIRRLYRSARRKRMYDQEQEQDQEQVEEQDLYPDMECYHCCCSACCIECR
*

IP07356.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5139-PA 179 CG5139-PA 1..179 22..200 939 100 Plus

IP07356.pep Sequence

Translation from 64 to 603

> IP07356.pep
MEKNLWNTLQEVEQVEVAFKQTLRNITDIQNRYKTVSALKSKASRRQESF
EAEIQGAITAPNPAKKRRVVKKSKINILKQRSLLPMPVPNLRSETILQVE
EPFVCLETNCVYEIHKTTTHLMARKPYGALIRRLYRSARRKRMYDQEQEQ
DQEQVEEQDLYPDMECYHCCCSACCIECR*

IP07356.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14729-PA 161 GF14729-PA 2..139 36..152 231 42.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24604-PA 191 GG24604-PA 1..191 1..179 621 69.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25289-PA 168 GH25289-PA 7..118 5..114 164 42.7 Plus
Dgri\GH10334-PA 168 GH10334-PA 7..118 5..114 161 42.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5139-PA 179 CG5139-PA 1..179 1..179 939 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17093-PA 174 GI17093-PA 6..62 5..61 151 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14957-PA 205 GL14957-PA 1..75 1..68 154 49.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18685-PA 205 GA18685-PA 1..75 1..68 154 49.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16617-PA 188 GM16617-PA 1..174 1..165 654 79.3 Plus
Dsec\GM23225-PA 186 GM23225-PA 1..134 41..165 443 73.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22918-PA 190 GD22918-PA 1..176 1..165 666 79.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10841-PA 178 GJ10841-PA 4..114 2..115 172 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14953-PA 271 GK14953-PA 59..224 12..150 173 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15688-PA 202 GE15688-PA 1..202 1..179 621 66.3 Plus