IP07372.complete Sequence
612 bp (612 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022808
> IP07372.complete
ACAATACAAAATACTTTCAAAATTAGTAAGATTTCTATTTGAACTCTGAT
CAAGTTCCGTACTTGCAGCTGAATTCTTTGATGGCTTCCATGGAGCTGAC
CCTGAAATCGGACTATTCCGCCGATTCTGTTATCGATGACATTATATCCA
AGTCGCTGGCATCCCAGGCAGTTCCAAGGACACACAAGAGATCAACTCGC
GTCTCCTTTCGATCCCTGGCCAAAGTTATAATGACTCTGATCGGAAACCT
CAAGAAGGCATCATCATTTCATGAGGTGAAGGACATAGACTACTGGCGTA
ATCTGGCCGAGTCCCGTTTGGAGGTCAACAATCGCTATGGGAGGTTTATC
GAAGCCCAGCAAAGGCGAATCTATACCCTGGAGACCAGGCTCCACAACCT
GGTCAATTTGGCCCGCGAGACCCAGAAAATGCTGGCCGAGATTGGGGCCG
AGAAGCGGGCCTGCGAGGAACTTGGCCATGGCGAGCACGCCGACTAGATT
TAGCATAATTTAATACTTTCCGTCTTTCATAAACCAATGGTTTATACTAA
ATAGTTGGTATGTGAGTTAAATATATACAAATTGAAAATCAAAAAAAAAA
AAAAAAAAAAAA
IP07372.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8840-RA | 590 | CG8840-RA | 7..590 | 1..584 | 2920 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:30:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3410233..3410822 | 1..590 | 2935 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:30:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3410610..3411201 | 1..592 | 2960 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3410610..3411201 | 1..592 | 2960 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 17:30:27 has no hits.
IP07372.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:31:37 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3410233..3410822 | 1..590 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:21 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..417 | 81..497 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:29 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..417 | 81..497 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:10 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..417 | 81..497 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:55 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..417 | 81..497 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:23 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..417 | 81..497 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:42 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 7..586 | 1..580 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:29 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 1..590 | 1..590 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:10 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 51..640 | 1..590 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:55 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 7..586 | 1..580 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:23 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8840-RA | 51..640 | 1..590 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3410610..3411199 | 1..590 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3410610..3411199 | 1..590 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3410610..3411199 | 1..590 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:10 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3410610..3411199 | 1..590 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:29 Download gff for
IP07372.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3410610..3411199 | 1..590 | 100 | | Plus |
IP07372.hyp Sequence
Translation from 80 to 496
> IP07372.hyp
MASMELTLKSDYSADSVIDDIISKSLASQAVPRTHKRSTRVSFRSLAKVI
MTLIGNLKKASSFHEVKDIDYWRNLAESRLEVNNRYGRFIEAQQRRIYTL
ETRLHNLVNLARETQKMLAEIGAEKRACEELGHGEHAD*
IP07372.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8840-PA | 138 | CG8840-PA | 1..138 | 1..138 | 690 | 100 | Plus |
IP07372.pep Sequence
Translation from 80 to 496
> IP07372.pep
MASMELTLKSDYSADSVIDDIISKSLASQAVPRTHKRSTRVSFRSLAKVI
MTLIGNLKKASSFHEVKDIDYWRNLAESRLEVNNRYGRFIEAQQRRIYTL
ETRLHNLVNLARETQKMLAEIGAEKRACEELGHGEHAD*
IP07372.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14184-PA | 169 | GF14184-PA | 28..169 | 5..138 | 285 | 44.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24938-PA | 141 | GG24938-PA | 17..141 | 3..138 | 480 | 69.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8840-PA | 138 | CG8840-PA | 1..138 | 1..138 | 690 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18416-PA | 32 | GM18416-PA | 1..32 | 107..138 | 145 | 87.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23227-PA | 138 | GD23227-PA | 1..138 | 1..138 | 613 | 83.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19070-PA | 131 | GK19070-PA | 27..122 | 32..132 | 212 | 49.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18230-PA | 132 | GE18230-PA | 1..132 | 1..138 | 529 | 76.1 | Plus |