Clone IP07372 Report

Search the DGRC for IP07372

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:73
Well:72
Vector:pOT2
Associated Gene/TranscriptCG8840-RA
Protein status:IP07372.pep: gold
Preliminary Size:586
Sequenced Size:612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8840 2005-01-01 Successful iPCR screen
CG8840 2008-04-29 Release 5.5 accounting
CG8840 2008-08-15 Release 5.9 accounting
CG8840 2008-12-18 5.12 accounting

Clone Sequence Records

IP07372.complete Sequence

612 bp (612 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022808

> IP07372.complete
ACAATACAAAATACTTTCAAAATTAGTAAGATTTCTATTTGAACTCTGAT
CAAGTTCCGTACTTGCAGCTGAATTCTTTGATGGCTTCCATGGAGCTGAC
CCTGAAATCGGACTATTCCGCCGATTCTGTTATCGATGACATTATATCCA
AGTCGCTGGCATCCCAGGCAGTTCCAAGGACACACAAGAGATCAACTCGC
GTCTCCTTTCGATCCCTGGCCAAAGTTATAATGACTCTGATCGGAAACCT
CAAGAAGGCATCATCATTTCATGAGGTGAAGGACATAGACTACTGGCGTA
ATCTGGCCGAGTCCCGTTTGGAGGTCAACAATCGCTATGGGAGGTTTATC
GAAGCCCAGCAAAGGCGAATCTATACCCTGGAGACCAGGCTCCACAACCT
GGTCAATTTGGCCCGCGAGACCCAGAAAATGCTGGCCGAGATTGGGGCCG
AGAAGCGGGCCTGCGAGGAACTTGGCCATGGCGAGCACGCCGACTAGATT
TAGCATAATTTAATACTTTCCGTCTTTCATAAACCAATGGTTTATACTAA
ATAGTTGGTATGTGAGTTAAATATATACAAATTGAAAATCAAAAAAAAAA
AAAAAAAAAAAA

IP07372.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8840-RA 590 CG8840-RA 7..590 1..584 2920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3410233..3410822 1..590 2935 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3410610..3411201 1..592 2960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3410610..3411201 1..592 2960 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:30:27 has no hits.

IP07372.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:31:37 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3410233..3410822 1..590 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:21 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..417 81..497 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:29 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..417 81..497 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:38:10 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..417 81..497 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:55 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..417 81..497 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:23 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..417 81..497 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:42 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 7..586 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:29 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:38:10 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 51..640 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:55 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 7..586 1..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:23 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
CG8840-RA 51..640 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3410610..3411199 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3410610..3411199 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:31:37 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3410610..3411199 1..590 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:38:10 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3410610..3411199 1..590 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:29 Download gff for IP07372.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3410610..3411199 1..590 100   Plus

IP07372.hyp Sequence

Translation from 80 to 496

> IP07372.hyp
MASMELTLKSDYSADSVIDDIISKSLASQAVPRTHKRSTRVSFRSLAKVI
MTLIGNLKKASSFHEVKDIDYWRNLAESRLEVNNRYGRFIEAQQRRIYTL
ETRLHNLVNLARETQKMLAEIGAEKRACEELGHGEHAD*

IP07372.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8840-PA 138 CG8840-PA 1..138 1..138 690 100 Plus

IP07372.pep Sequence

Translation from 80 to 496

> IP07372.pep
MASMELTLKSDYSADSVIDDIISKSLASQAVPRTHKRSTRVSFRSLAKVI
MTLIGNLKKASSFHEVKDIDYWRNLAESRLEVNNRYGRFIEAQQRRIYTL
ETRLHNLVNLARETQKMLAEIGAEKRACEELGHGEHAD*

IP07372.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14184-PA 169 GF14184-PA 28..169 5..138 285 44.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24938-PA 141 GG24938-PA 17..141 3..138 480 69.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8840-PA 138 CG8840-PA 1..138 1..138 690 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18416-PA 32 GM18416-PA 1..32 107..138 145 87.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23227-PA 138 GD23227-PA 1..138 1..138 613 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19070-PA 131 GK19070-PA 27..122 32..132 212 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18230-PA 132 GE18230-PA 1..132 1..138 529 76.1 Plus