Clone IP07373 Report

Search the DGRC for IP07373

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:73
Well:73
Vector:pOT2
Associated Gene/TranscriptCG9072-RA
Protein status:IP07373.pep: gold
Preliminary Size:545
Sequenced Size:604

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9072 2005-01-01 Successful iPCR screen
CG9072 2008-04-29 Release 5.5 accounting
CG9072 2008-08-15 Release 5.9 accounting
CG9072 2008-12-18 5.12 accounting

Clone Sequence Records

IP07373.complete Sequence

604 bp (604 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022809

> IP07373.complete
ATTCGAATCACTAGCCCAATGTCGGTGCCTACATATTCATAAACCATCTC
ATCCGTTATCCGTTGTAGTGATCAGTTAGTGCCATGTACAATCGCCACAT
CGCCCACTTATCGGCCGTGCAGGCCAACGATACGCGCCATAATGCCACGC
TGCGTTTCCAGAGTCGTCCCACGGATAACGTCTACTCGGATCCACGCCTC
GAGCAACTGATTGTCTATCGGGCTTTGTTGCAGCACCTGCTGCAACAGAA
GGATCACTATGATCACGAACGGGAGCTGGAACTCCAGCGTCTCGAGCGCT
TTCGCAGCGAGGGAGCCAACGAGCGCCGTTTGCAGATCCAGGAGCAAGTG
CTCAAAAAGGCACAGGGCATGCTGCCTGGCATCGTTTTCAAAATGCGCAA
CGAGGTGGACAAGCTGAAGCGCTTCCTCGACATCGACAAGCAGCAGGAGC
TGCGCCAACTGGACACCGCCCTCTACGACAACTGCGTCGAGCTACTCAAT
AACTGTCAATCTTCTCTGGAAAACATTAATTGAGCTGCCAAGTTAAATTT
CAACATTCTCATTTGTCAAATTAAATAGTGCAAACAAAAAAAAAAAAAAA
AAAA

IP07373.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG9072-RA 581 CG9072-RA 1..581 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14985621..14986205 585..1 2925 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:51:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15095443..15096042 600..1 2970 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15103541..15104140 600..1 2970 99.6 Minus
Blast to na_te.dros performed 2019-03-16 06:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 3212..3359 390..534 145 61.6 Plus

IP07373.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:16:54 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14985621..14986205 1..585 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:21 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..450 84..533 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:31 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..450 84..533 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:37 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..450 84..533 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:56 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..450 84..533 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:49 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..450 84..533 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:44 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..545 10..554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:31 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..545 10..554 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:37 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..585 1..585 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:56 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..545 10..554 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:49 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
CG9072-RA 1..585 1..585 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:54 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
X 15095458..15096042 1..585 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:54 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
X 15095458..15096042 1..585 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:54 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
X 15095458..15096042 1..585 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:37 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14989491..14990075 1..585 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:30 Download gff for IP07373.complete
Subject Subject Range Query Range Percent Splice Strand
X 15103556..15104140 1..585 100   Minus

IP07373.pep Sequence

Translation from 83 to 532

> IP07373.pep
MYNRHIAHLSAVQANDTRHNATLRFQSRPTDNVYSDPRLEQLIVYRALLQ
HLLQQKDHYDHERELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPGI
VFKMRNEVDKLKRFLDIDKQQELRQLDTALYDNCVELLNNCQSSLENIN*

IP07373.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21056-PA 149 GF21056-PA 1..147 1..147 525 70.7 Plus
Dana\GF23254-PA 110 GF23254-PA 2..108 35..145 149 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19419-PA 150 GG19419-PA 1..148 1..147 649 83.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9072-PA 149 CG9072-PA 1..149 1..149 766 100 Plus
CG1890-PA 110 CG1890-PA 2..109 35..146 140 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21556-PA 134 GI21556-PA 23..131 36..146 300 53.2 Plus
Dmoj\GI23130-PA 110 GI23130-PA 2..108 35..145 155 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15205-PA 150 GL15205-PA 2..148 5..147 344 58.8 Plus
Dper\GL15176-PA 150 GL15176-PA 2..148 5..147 344 58.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21519-PA 152 GA21519-PA 2..150 5..147 341 58 Plus
Dpse\GA22799-PA 154 GA22799-PA 2..152 5..147 339 57.2 Plus
Dpse\GA15111-PA 110 GA15111-PA 2..108 35..145 154 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12006-PA 144 GM12006-PA 1..144 1..149 604 88.6 Plus
Dsec\GM16448-PA 110 GM16448-PA 2..110 35..147 133 29.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15820-PA 144 GD15820-PA 1..143 1..148 609 89.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15700-PA 134 GJ15700-PA 23..131 36..146 325 55.9 Plus
Dvir\GJ23104-PA 110 GJ23104-PA 2..110 35..147 157 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19246-PA 139 GK19246-PA 28..136 37..146 313 58.2 Plus
Dwil\GK12117-PA 110 GK12117-PA 2..108 35..145 146 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16070-PA 149 GE16070-PA 1..149 1..149 687 87.9 Plus

IP07373.hyp Sequence

Translation from 83 to 532

> IP07373.hyp
MYNRHIAHLSAVQANDTRHNATLRFQSRPTDNVYSDPRLEQLIVYRALLQ
HLLQQKDHYDHERELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPGI
VFKMRNEVDKLKRFLDIDKQQELRQLDTALYDNCVELLNNCQSSLENIN*

IP07373.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9072-PA 149 CG9072-PA 1..149 1..149 766 100 Plus
CG1890-PA 110 CG1890-PA 2..109 35..146 140 29.5 Plus