BDGP Sequence Production Resources |
Search the DGRC for IP07373
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 73 |
Well: | 73 |
Vector: | pOT2 |
Associated Gene/Transcript | CG9072-RA |
Protein status: | IP07373.pep: gold |
Preliminary Size: | 545 |
Sequenced Size: | 604 |
Gene | Date | Evidence |
---|---|---|
CG9072 | 2005-01-01 | Successful iPCR screen |
CG9072 | 2008-04-29 | Release 5.5 accounting |
CG9072 | 2008-08-15 | Release 5.9 accounting |
CG9072 | 2008-12-18 | 5.12 accounting |
604 bp (604 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022809
> IP07373.complete ATTCGAATCACTAGCCCAATGTCGGTGCCTACATATTCATAAACCATCTC ATCCGTTATCCGTTGTAGTGATCAGTTAGTGCCATGTACAATCGCCACAT CGCCCACTTATCGGCCGTGCAGGCCAACGATACGCGCCATAATGCCACGC TGCGTTTCCAGAGTCGTCCCACGGATAACGTCTACTCGGATCCACGCCTC GAGCAACTGATTGTCTATCGGGCTTTGTTGCAGCACCTGCTGCAACAGAA GGATCACTATGATCACGAACGGGAGCTGGAACTCCAGCGTCTCGAGCGCT TTCGCAGCGAGGGAGCCAACGAGCGCCGTTTGCAGATCCAGGAGCAAGTG CTCAAAAAGGCACAGGGCATGCTGCCTGGCATCGTTTTCAAAATGCGCAA CGAGGTGGACAAGCTGAAGCGCTTCCTCGACATCGACAAGCAGCAGGAGC TGCGCCAACTGGACACCGCCCTCTACGACAACTGCGTCGAGCTACTCAAT AACTGTCAATCTTCTCTGGAAAACATTAATTGAGCTGCCAAGTTAAATTT CAACATTCTCATTTGTCAAATTAAATAGTGCAAACAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9072-RA | 581 | CG9072-RA | 1..581 | 1..581 | 2905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 14985621..14986205 | 585..1 | 2925 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 15095443..15096042 | 600..1 | 2970 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 15103541..15104140 | 600..1 | 2970 | 99.6 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rt1b | 5171 | Rt1b RT1B 5150bp | 3212..3359 | 390..534 | 145 | 61.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 14985621..14986205 | 1..585 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..450 | 84..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..450 | 84..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..450 | 84..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..450 | 84..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..450 | 84..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..545 | 10..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..545 | 10..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..585 | 1..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..545 | 10..554 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9072-RA | 1..585 | 1..585 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15095458..15096042 | 1..585 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15095458..15096042 | 1..585 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15095458..15096042 | 1..585 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 14989491..14990075 | 1..585 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15103556..15104140 | 1..585 | 100 | Minus |
Translation from 83 to 532
> IP07373.pep MYNRHIAHLSAVQANDTRHNATLRFQSRPTDNVYSDPRLEQLIVYRALLQ HLLQQKDHYDHERELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPGI VFKMRNEVDKLKRFLDIDKQQELRQLDTALYDNCVELLNNCQSSLENIN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21056-PA | 149 | GF21056-PA | 1..147 | 1..147 | 525 | 70.7 | Plus |
Dana\GF23254-PA | 110 | GF23254-PA | 2..108 | 35..145 | 149 | 30.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19419-PA | 150 | GG19419-PA | 1..148 | 1..147 | 649 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9072-PA | 149 | CG9072-PA | 1..149 | 1..149 | 766 | 100 | Plus |
CG1890-PA | 110 | CG1890-PA | 2..109 | 35..146 | 140 | 29.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21556-PA | 134 | GI21556-PA | 23..131 | 36..146 | 300 | 53.2 | Plus |
Dmoj\GI23130-PA | 110 | GI23130-PA | 2..108 | 35..145 | 155 | 32.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15205-PA | 150 | GL15205-PA | 2..148 | 5..147 | 344 | 58.8 | Plus |
Dper\GL15176-PA | 150 | GL15176-PA | 2..148 | 5..147 | 344 | 58.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21519-PA | 152 | GA21519-PA | 2..150 | 5..147 | 341 | 58 | Plus |
Dpse\GA22799-PA | 154 | GA22799-PA | 2..152 | 5..147 | 339 | 57.2 | Plus |
Dpse\GA15111-PA | 110 | GA15111-PA | 2..108 | 35..145 | 154 | 30.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12006-PA | 144 | GM12006-PA | 1..144 | 1..149 | 604 | 88.6 | Plus |
Dsec\GM16448-PA | 110 | GM16448-PA | 2..110 | 35..147 | 133 | 29.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15820-PA | 144 | GD15820-PA | 1..143 | 1..148 | 609 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15700-PA | 134 | GJ15700-PA | 23..131 | 36..146 | 325 | 55.9 | Plus |
Dvir\GJ23104-PA | 110 | GJ23104-PA | 2..110 | 35..147 | 157 | 31.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19246-PA | 139 | GK19246-PA | 28..136 | 37..146 | 313 | 58.2 | Plus |
Dwil\GK12117-PA | 110 | GK12117-PA | 2..108 | 35..145 | 146 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16070-PA | 149 | GE16070-PA | 1..149 | 1..149 | 687 | 87.9 | Plus |
Translation from 83 to 532
> IP07373.hyp MYNRHIAHLSAVQANDTRHNATLRFQSRPTDNVYSDPRLEQLIVYRALLQ HLLQQKDHYDHERELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPGI VFKMRNEVDKLKRFLDIDKQQELRQLDTALYDNCVELLNNCQSSLENIN*