Clone IP07416 Report

Search the DGRC for IP07416

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:74
Well:16
Vector:pOT2
Associated Gene/TranscriptCG31949-RA
Protein status:IP07416.pep: gold
Preliminary Size:599
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31949 2005-01-01 Successful iPCR screen
CG31949 2008-04-29 Release 5.5 accounting
CG31949 2008-08-15 Release 5.9 accounting
CG31949 2008-12-18 5.12 accounting

Clone Sequence Records

IP07416.complete Sequence

711 bp (711 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022833

> IP07416.complete
TCCAATTGAAGTAATCGGAAGCAGTTGTTAGAAAATTCGTAGTTTTTTAC
AAATTGAAAATTTTCTACACAAGACAAAATGGAGGCATCGTTTATGGTTG
CCCTGTTCCTTTCGTTATTTTTCCACTGCACAGGACTGGTCCCGAGTCCC
GTGGAAGCAAGACCGGATTCGCTTCTCTTCTTACTTATCGCCATAATCTT
TCTGCATAAATTGAAGATGAAGTACGGGCCAATTCTTCCAGAAACCATAA
CGGGAGCAATCCTCGAGGTTCCGGTCCTATGTTTGGCTCTCCAGGTGGCT
TTGCTAGTCCTTTGGGGGCCCATGTTTTATATCCTGCAATGGTTGGTGGA
TTCTGCCAGCAGAAATCTGAGATATTGTCTGAATGAGCAACTCTCCTTGA
TGGTAAAGGATATCACTCCGCTTATACTGACAATGGTTCTTATGGCTGTG
GAATCGGCTGTGTTTCTCAACTGTTTCCAGATCAGCGATATGCAGAAGTT
CTTTGGCTGCAAGGAAGACTGCGTCACACCCAGTGTCCTTTCATTTATAG
CCGAGGAAGAGACCAAGATGTTAAAACGGGACATAAGAAAGTGGAAAAAA
ACCCACAAGAAGTGAAGTATTGAAATAGGACAACCATTTTGTCAAATAAG
CAATTATAATTAATAACTTGTCAAATTGAATATTTGCAATCTGAAAAAAA
AAAAAAAAAAA

IP07416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG31949-RA 693 CG31949-RA 1..693 1..693 3465 100 Plus
CG31949.a 774 CG31949.a 33..434 1..402 2010 100 Plus
CG31949.a 774 CG31949.a 434..650 480..696 1085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2299844..2300536 1..693 3465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2300103..2300798 1..696 3480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2300103..2300798 1..696 3480 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:37:21 has no hits.

IP07416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:38:33 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2299844..2300536 1..693 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:26 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..537 79..615 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:32 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..537 79..615 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:40:14 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..537 79..615 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:57 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..537 79..615 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:18:00 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..537 79..615 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:46 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..599 17..615 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:32 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..693 1..693 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:40:14 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..693 1..693 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:57 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..599 17..615 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:18:00 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
CG31949-RA 1..693 1..693 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:33 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2300103..2300795 1..693 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:33 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2300103..2300795 1..693 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:38:33 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2300103..2300795 1..693 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:40:14 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2300103..2300795 1..693 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:31 Download gff for IP07416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2300103..2300795 1..693 100   Plus

IP07416.pep Sequence

Translation from 78 to 614

> IP07416.pep
MEASFMVALFLSLFFHCTGLVPSPVEARPDSLLFLLIAIIFLHKLKMKYG
PILPETITGAILEVPVLCLALQVALLVLWGPMFYILQWLVDSASRNLRYC
LNEQLSLMVKDITPLILTMVLMAVESAVFLNCFQISDMQKFFGCKEDCVT
PSVLSFIAEEETKMLKRDIRKWKKTHKK*

IP07416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14617-PA 192 GF14617-PA 1..168 1..168 252 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24845-PA 183 GG24845-PA 1..175 1..178 564 61.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31949-PA 178 CG31949-PA 1..178 1..178 913 100 Plus
CG31949-PB 152 CG31949-PB 1..152 1..178 749 85.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18330-PA 177 GM18330-PA 1..177 1..177 745 81.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23145-PA 177 GD23145-PA 1..177 1..177 737 81.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18106-PA 183 GE18106-PA 1..175 1..178 533 59.6 Plus

IP07416.hyp Sequence

Translation from 78 to 614

> IP07416.hyp
MEASFMVALFLSLFFHCTGLVPSPVEARPDSLLFLLIAIIFLHKLKMKYG
PILPETITGAILEVPVLCLALQVALLVLWGPMFYILQWLVDSASRNLRYC
LNEQLSLMVKDITPLILTMVLMAVESAVFLNCFQISDMQKFFGCKEDCVT
PSVLSFIAEEETKMLKRDIRKWKKTHKK*

IP07416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31949-PA 178 CG31949-PA 1..178 1..178 913 100 Plus
CG31949-PB 152 CG31949-PB 1..152 1..178 749 85.4 Plus