Clone IP07454 Report

Search the DGRC for IP07454

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:74
Well:54
Vector:pOT2
Associated Gene/TranscriptCG4627-RA
Protein status:IP07454.pep: gold
Preliminary Size:561
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4627 2005-01-01 Successful iPCR screen
CG4627 2008-04-29 Release 5.5 accounting
CG4627 2008-08-15 Release 5.9 accounting
CG4627 2008-12-18 5.12 accounting

Clone Sequence Records

IP07454.complete Sequence

959 bp (959 high quality bases) assembled on 2006-09-20

GenBank Submission: BT029064

> IP07454.complete
AGGCATATTTGTAAATATGATATTAGCTCGGCTAACTATAACATAAAGTG
CTAACGTAAATATACATGTTGAGTTGGAAAAAGTAATATTACCAAAACCT
TACACTTTGATCAAATTACCCCGAGTAAACACACCCACAAATCAATGCAA
TGCTGGAGCTGCTGTGCCGGGTCAGTCCTGCAAGATTGCCATGGAGAAGC
TGCATGTCCCTAGCCATTCAGCCGGCACAGAGACGCCGCTTTGCAACAGA
GGCTGCCGGAAAAAGAACGGAAACCGAAAAATCTGCATTCACTGAATGGC
GCACCGTCTATAGTATGCCGGGCATACGGCTCGTGGCCGCATTAAGTAGG
TTGAAAGTCTACCAGGCTGTCATCACGGCCGCCGGAACGCCCATTGTCTT
CGCCCTGGGCAGCGCCGGGCAACTCAGCACGGATGCACTGGCCATCTATG
CCGCCATTGGAGTCACTGGCCTGATCACCCTCACACTAGCCAGCTACGCG
TCCTCAAATCTCGTGGGCTTCATCTACGTGAACGAGGAACAGGATCTGCT
CAAGCTGGCCTACGTAGACTTCTGGGGACGGCGACAGGAGACACTCATTG
AAACCGAGGATCTGCTGCCGAGCTGGGAGCAGGGAAGTCCGTCTCGACTC
AGATTCGTTTCGCCCATTTGCTTGCGCAGCGATTCCAAAAGGCGCTACAA
ACTCCTTAATCGCTTCGGTCATGTCAGCGATCGCCAGTTGTTTGAGGGTC
TCTTTGGAAATTGAATATACATTTAGGCGATTGTTATACCAGAGATACCC
ATTTGTTAATATCTGAATTAGAAAATCATGCCATCTTTTTGTATACAATA
CTTTATAACGAGTATTTTTTAAGGTCAGCTACATCGCTTTATATAAATAT
ATGTGTATATTGCTGATCGGTGGCAAATATGTCCATCCAAACAAAAAAAA
AAAAAAAAA

IP07454.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG4627-RA 1062 CG4627-RA 118..1061 1..944 4720 100 Plus
CG4630-RA 2180 CG4630-RA 2072..2180 944..836 545 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9102293..9103084 151..942 3945 99.9 Plus
chr2R 21145070 chr2R 9102076..9102225 1..150 750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13214969..13215762 151..944 3970 100 Plus
2R 25286936 2R 13214752..13214901 1..150 750 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13216168..13216961 151..944 3970 100 Plus
2R 25260384 2R 13215951..13216100 1..150 750 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:50:11 has no hits.

IP07454.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:50:48 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9102076..9102225 1..150 100 -> Plus
chr2R 9102293..9103084 151..942 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:30 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 1..615 150..764 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:26:49 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 1..615 150..764 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 1..615 150..764 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:47:00 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 1..615 150..764 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:01 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 1..615 150..764 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:55:29 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 20..961 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:26:48 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 20..961 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 47..988 1..942 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:47:01 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 12..775 1..764 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:01 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
CG4627-RA 47..988 1..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:48 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13214752..13214901 1..150 100 -> Plus
2R 13214969..13215760 151..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:48 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13214752..13214901 1..150 100 -> Plus
2R 13214969..13215760 151..942 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:48 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13214752..13214901 1..150 100 -> Plus
2R 13214969..13215760 151..942 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:13 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9102257..9102406 1..150 100 -> Plus
arm_2R 9102474..9103265 151..942 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:53:33 Download gff for IP07454.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13215951..13216100 1..150 100 -> Plus
2R 13216168..13216959 151..942 100   Plus

IP07454.hyp Sequence

Translation from 149 to 763

> IP07454.hyp
MLELLCRVSPARLPWRSCMSLAIQPAQRRRFATEAAGKRTETEKSAFTEW
RTVYSMPGIRLVAALSRLKVYQAVITAAGTPIVFALGSAGQLSTDALAIY
AAIGVTGLITLTLASYASSNLVGFIYVNEEQDLLKLAYVDFWGRRQETLI
ETEDLLPSWEQGSPSRLRFVSPICLRSDSKRRYKLLNRFGHVSDRQLFEG
LFGN*

IP07454.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4627-PA 204 CG4627-PA 1..204 1..204 1033 100 Plus

IP07454.pep Sequence

Translation from 149 to 763

> IP07454.pep
MLELLCRVSPARLPWRSCMSLAIQPAQRRRFATEAAGKRTETEKSAFTEW
RTVYSMPGIRLVAALSRLKVYQAVITAAGTPIVFALGSAGQLSTDALAIY
AAIGVTGLITLTLASYASSNLVGFIYVNEEQDLLKLAYVDFWGRRQETLI
ETEDLLPSWEQGSPSRLRFVSPICLRSDSKRRYKLLNRFGHVSDRQLFEG
LFGN*

IP07454.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20364-PA 207 GG20364-PA 3..207 1..204 883 83.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:36:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25009-PA 214 GH25009-PA 1..213 1..204 581 54.7 Plus
Dgri\GH22880-PA 214 GH22880-PA 1..213 1..204 578 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4627-PA 204 CG4627-PA 1..204 1..204 1033 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21264-PA 191 GI21264-PA 19..191 32..204 587 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11556-PA 102 GL11556-PA 10..102 112..204 385 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18314-PA 160 GA18314-PA 2..160 48..204 526 64 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21451-PA 186 GM21451-PA 1..186 19..204 888 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10950-PA 186 GD10950-PA 1..186 19..204 876 88.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20867-PA 196 GJ20867-PA 37..196 45..204 569 63.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17913-PA 180 GK17913-PA 8..180 33..204 515 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12524-PA 186 GE12524-PA 1..186 19..204 851 84.4 Plus