Clone IP07462 Report

Search the DGRC for IP07462

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:74
Well:62
Vector:pOT2
Associated Gene/TranscriptVha16-5-RA
Protein status:IP07462.pep: gold
Preliminary Size:582
Sequenced Size:1085

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6737 2005-01-01 Successful iPCR screen
CG6737 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP07462.complete Sequence

1085 bp (1085 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022859

> IP07462.complete
CTCGCTTGTTTTTGAATTTGGCTGCTCGGTTCCGTGGGTCGCCGGAATCG
CGTACCGTCCTCCGACCCGTTGTCTGGTTAGCTGCGACTGCCAGGAGCTG
CGACTCGAGCGAATGCAGCGCATCGCCCAATCGCAATTCTGCAGAGCCAA
AATCGCAATTGCAAGCGTCTTCGCCGTGCGTACAACAAATAAAAGAAAAA
TGTTTTATGTTGGGCGGCCCTTGCACGATTGGACGGCAGCATATCGTCAT
GCAAGCGTTTCGTGCACGTCGCCAGCATGATGACCGATAAACCGCGCAGC
TTCAAATTCAAACCGCAATCGATTGTTACATCTTTCGAAGGCTAGTCAGA
CTAACAAGTTGGAAAATCCAGAAAGCAAGCAACGTGGATCGTTCCTTTTC
AAGTAAATACGAAAAAGGCTACCAAAATGGAAATGGATTACTATCTGCCA
GTGTATAACGGATCAAATTCGGTGGACGTGCCGGGGCTGATTGAAAGTCT
CAAGCTGAAGGAAACCAGTATATCGCCAATCGTGCTGGATCGCTATCCGC
CGTACTCCCCGTTCTATGGCGTGATGGGCGTCGTATTCTCCAGTGTGCTG
ACCTCCGCTGGAGCGGCCTACGGAACTGCTGTTTCCGGAACTGGAATCGC
CGCCACAGCGGTGATGCGTCCCGAGCTGGTGATGAAGTCCATCATTCCGG
TGGTCATGGCGGGCATCATTGCCATATACGGTCTGGTGGTATCCGTGCTC
CTATCTGGGGAACTAGCGCCTGCTCCCAAATACTCGCTGCCCACCGGCTA
TGTACACCTGGCCGCTGGACTTTCGGTGGGATTTGCTGGACTGGCTGCCG
GATATGCAGTGGGTGAAGTCGGCGAAGTGGGCGTGCGGCACATTGCCCTG
CAGCCACGCCTCTTTATCGGCATGATCCTGATCCTTATTTTCGCCGAGGT
GCTCGGTCTCTACGGCCTGATCATTGGGATTTATTTGTACACGGTCAACA
TTAAGTAGCAGAATTTGTTATATCTAAAATATTTAATTCGTTAAGAAACG
TTTTTATCGATCTTTAAAAAAAAAAAAAAAAAAAA

IP07462.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG6737-RA 1065 CG6737-RA 1..1065 1..1065 5325 100 Plus
CG12299-RA 3313 CG12299-RA 1..232 232..1 1160 100 Minus
Vha16.a 2692 Vha16.a 126..205 661..740 265 88.7 Plus
Vha16.a 2692 Vha16.a 384..458 919..993 165 81.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10735083..10735809 1065..339 3635 100 Minus
chr2L 23010047 chr2L 10736000..10736340 341..1 1705 100 Minus
chr3L 24539361 chr3L 11464508..11464695 805..992 295 77.1 Plus
chr2R 21145070 chr2R 2514985..2515064 740..661 265 88.8 Minus
chr3L 24539361 chr3L 11465906..11466042 610..746 235 78.1 Plus
chr3L 24539361 chr3L 11466191..11466282 901..992 190 80.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10736317..10737045 1067..339 3645 100 Minus
2L 23513712 2L 10737236..10737576 341..1 1705 100 Minus
3L 28110227 3L 11473690..11473877 805..992 280 76.6 Plus
2R 25286936 2R 6627786..6627865 740..661 265 88.8 Minus
3L 28110227 3L 11475088..11475224 610..746 220 77.4 Plus
3L 28110227 3L 11475373..11475464 901..992 190 80.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10736317..10737045 1067..339 3645 100 Minus
2L 23513712 2L 10737236..10737576 341..1 1705 100 Minus
2R 25260384 2R 6628985..6629064 740..661 265 88.7 Minus
3L 28103327 3L 11466868..11466977 883..992 250 81.8 Plus
3L 28103327 3L 11468473..11468564 901..992 190 80.4 Plus
3L 28103327 3L 11468260..11468324 682..746 190 86.1 Plus
2R 25260384 2R 6628675..6628749 993..919 165 81.3 Minus
Blast to na_te.dros performed on 2019-03-16 06:59:43 has no hits.

IP07462.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10735083..10735809 339..1065 100 -> Minus
chr2L 10736003..10736340 1..338 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
CG6737-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:33 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:38 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:58 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
CG6737-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:28 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:48 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
CG6737-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:33 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..1065 1..1065 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:38 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..725 341..1065 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:58 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
CG6737-RA 1..582 427..1008 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:28 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-5-RA 1..725 341..1065 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10736319..10737043 341..1065 100 <- Minus
2L 10737237..10737576 1..340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10736319..10737043 341..1065 100 <- Minus
2L 10737237..10737576 1..340 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10736319..10737043 341..1065 100 <- Minus
2L 10737237..10737576 1..340 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:38 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10736319..10737043 341..1065 100 <- Minus
arm_2L 10737237..10737576 1..340 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:32 Download gff for IP07462.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10737237..10737576 1..340 100   Minus
2L 10736319..10737043 341..1065 100 <- Minus

IP07462.pep Sequence

Translation from 426 to 1007

> IP07462.pep
MEMDYYLPVYNGSNSVDVPGLIESLKLKETSISPIVLDRYPPYSPFYGVM
GVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAI
YGLVVSVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGE
VGVRHIALQPRLFIGMILILIFAEVLGLYGLIIGIYLYTVNIK*

IP07462.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19671-PA 180 GF19671-PA 10..180 22..193 637 77.3 Plus
Dana\GF25265-PA 157 GF25265-PA 3..156 33..189 512 70.1 Plus
Dana\GF13808-PA 159 GF13808-PA 1..158 32..189 510 67.7 Plus
Dana\GF25266-PA 159 GF25266-PA 10..158 41..191 378 62.3 Plus
Dana\GF13441-PA 202 GF13441-PA 22..138 46..164 290 52.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10362-PA 191 GG10362-PA 1..191 3..193 856 92.1 Plus
Dere\GG15504-PA 158 GG15504-PA 9..157 38..189 518 72.4 Plus
Dere\GG10820-PA 159 GG10820-PA 1..158 32..189 513 68.4 Plus
Dere\GG15505-PA 158 GG15505-PA 6..156 37..189 455 62.7 Plus
Dere\GG22236-PA 158 GG22236-PA 8..157 37..189 400 54.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10920-PA 173 GH10920-PA 21..173 40..192 579 79.1 Plus
Dgri\GH16652-PA 161 GH16652-PA 11..160 38..189 524 71.7 Plus
Dgri\GH12724-PA 161 GH12724-PA 11..160 38..189 524 71.7 Plus
Dgri\GH22892-PA 161 GH22892-PA 12..160 41..189 508 70.5 Plus
Dgri\GH16653-PA 159 GH16653-PA 11..157 41..189 428 61.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-5-PA 193 CG6737-PA 1..193 1..193 958 100 Plus
Vha16-1-PB 159 CG3161-PB 10..158 41..189 539 71.1 Plus
Vha16-1-PA 159 CG3161-PA 10..158 41..189 539 71.1 Plus
Vha16-1-PD 159 CG3161-PD 10..158 41..189 539 71.1 Plus
Vha16-1-PC 159 CG3161-PC 10..158 41..189 539 71.1 Plus
Vha16-3-PB 158 CG32090-PB 11..157 41..189 532 72.5 Plus
Vha16-3-PA 158 CG32090-PA 11..157 41..189 532 72.5 Plus
Vha16-2-PA 158 CG32089-PA 6..156 37..189 462 61.4 Plus
Vha16-4-PA 155 CG9013-PA 8..154 41..189 417 55 Plus
VhaPPA1-1-PB 212 CG7007-PB 48..202 42..187 229 34.4 Plus
VhaPPA1-1-PA 212 CG7007-PA 48..202 42..187 229 34.4 Plus
VhaPPA1-2-PB 212 CG7026-PB 49..204 44..187 217 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13313-PA 175 GI13313-PA 11..175 28..192 569 70.3 Plus
Dmoj\GI21278-PA 159 GI21278-PA 10..158 41..189 510 69.8 Plus
Dmoj\GI11612-PA 158 GI11612-PA 8..157 38..189 510 69.1 Plus
Dmoj\GI11613-PA 158 GI11613-PA 8..156 38..189 412 57.9 Plus
Dmoj\GI22994-PA 212 GI22994-PA 43..202 37..187 192 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26032-PA 182 GL26032-PA 27..182 37..192 608 80.1 Plus
Dper\GL21511-PA 162 GL21511-PA 13..161 38..189 519 71.7 Plus
Dper\GL20293-PA 159 GL20293-PA 1..158 32..189 515 68.4 Plus
Dper\GL10499-PA 165 GL10499-PA 3..164 26..189 440 58.8 Plus
Dper\GL10498-PA 165 GL10498-PA 4..164 27..189 437 59.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25245-PA 182 GA25245-PA 27..182 37..192 607 80.1 Plus
Dpse\GA26304-PA 162 GA26304-PA 13..161 38..189 518 71.7 Plus
Dpse\GA16335-PA 159 GA16335-PA 1..158 32..189 515 68.4 Plus
Dpse\GA21477-PA 165 GA21477-PA 4..164 27..189 438 59.1 Plus
Dpse\GA26306-PA 159 GA26306-PA 6..157 27..189 380 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11483-PA 191 GM11483-PA 1..191 3..193 909 96.9 Plus
Dsec\GM25273-PA 158 GM25273-PA 11..157 41..189 515 72.5 Plus
Dsec\GM20869-PA 159 GM20869-PA 1..158 32..189 513 68.4 Plus
Dsec\GM25274-PA 158 GM25274-PA 6..156 37..189 440 61.4 Plus
Dsec\GM20023-PA 158 GM20023-PA 8..157 37..189 404 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22230-PA 191 GD22230-PA 1..191 3..193 904 96.3 Plus
Dsim\GD14307-PA 158 GD14307-PA 11..157 41..189 515 72.5 Plus
Dsim\GD10321-PA 159 GD10321-PA 1..158 32..189 513 68.4 Plus
Dsim\GD14308-PA 165 GD14308-PA 6..163 37..189 425 59.5 Plus
Dsim\GD25509-PA 158 GD25509-PA 8..157 37..189 404 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11943-PA 179 GJ11943-PA 18..179 29..192 573 72.6 Plus
Dvir\GJ11291-PA 159 GJ11291-PA 9..158 38..189 527 72.4 Plus
Dvir\GJ20880-PA 158 GJ20880-PA 6..157 38..189 512 69.1 Plus
Dvir\GJ11292-PA 159 GJ11292-PA 8..157 38..189 465 63.2 Plus
Dvir\GJ24692-PA 212 GJ24692-PA 43..202 37..187 189 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18316-PA 184 GK18316-PA 5..184 14..193 593 67.8 Plus
Dwil\GK17170-PA 160 GK17170-PA 10..159 38..189 512 70.4 Plus
Dwil\GK19648-PA 159 GK19648-PA 1..158 32..189 511 67.7 Plus
Dwil\GK17171-PA 160 GK17171-PA 9..158 38..189 446 61.8 Plus
Dwil\GK22034-PA 160 GK22034-PA 13..159 41..189 432 63.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13384-PA 191 GE13384-PA 1..191 3..193 792 90.1 Plus
Dyak\Vha16-PA 159 GE24687-PA 1..158 32..189 513 68.4 Plus
Dyak\GE21812-PA 158 GE21812-PA 11..157 41..189 512 71.8 Plus
Dyak\GE21813-PA 158 GE21813-PA 6..156 37..189 442 61.4 Plus
Dyak\GE14233-PA 158 GE14233-PA 8..157 37..189 400 55.6 Plus

IP07462.hyp Sequence

Translation from 426 to 1007

> IP07462.hyp
MEMDYYLPVYNGSNSVDVPGLIESLKLKETSISPIVLDRYPPYSPFYGVM
GVVFSSVLTSAGAAYGTAVSGTGIAATAVMRPELVMKSIIPVVMAGIIAI
YGLVVSVLLSGELAPAPKYSLPTGYVHLAAGLSVGFAGLAAGYAVGEVGE
VGVRHIALQPRLFIGMILILIFAEVLGLYGLIIGIYLYTVNIK*

IP07462.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-5-PA 193 CG6737-PA 1..193 1..193 958 100 Plus
Vha16-1-PB 159 CG3161-PB 10..158 41..189 539 71.1 Plus
Vha16-1-PA 159 CG3161-PA 10..158 41..189 539 71.1 Plus
Vha16-1-PD 159 CG3161-PD 10..158 41..189 539 71.1 Plus
Vha16-1-PC 159 CG3161-PC 10..158 41..189 539 71.1 Plus