Clone IP07479 Report

Search the DGRC for IP07479

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:74
Well:79
Vector:pOT2
Associated Gene/TranscriptCG9406-RA
Protein status:IP07479.pep: gold
Preliminary Size:593
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9406 2005-01-01 Successful iPCR screen
CG9406 2008-04-29 Release 5.5 accounting
CG9406 2008-08-15 Release 5.9 accounting
CG9406 2008-12-18 5.12 accounting

Clone Sequence Records

IP07479.complete Sequence

710 bp (710 high quality bases) assembled on 2006-04-13

GenBank Submission: BT025129

> IP07479.complete
AAAAAATAAATCGTATTTTAAAATTATCAGTTTATTTATTAAATTCTAAA
GTATATACCCGCGATGGAAGTTGGTGTTACCCTAAACAACGAACTCGAGG
AAAAGATTTCGGAAGCATTTTGCATATTTGATACTCATGGCGATAAGTAT
ATTGATTCCCGCAATGTCGGCAACGTGCTCCGATTTTTAGGTTGCGCGCC
CACCGAAAAAGAGGTCGAAGATGTCATTAAAGCCACCGATTCCGTCGACT
ATCCAGGCGAAGCCCATTTGGTGAAGTTCATGGAACACGTTTCCAAACTG
CTGATGGATCGACAAATGGAACCAGCCTCGTCGGAAAAGCTTCTCGAGGC
CTTTGAGACCCTGGATCCAGAAAATAAAAAATATCTGACCAAGGAGTACT
TCGGCAAATTAATGGCGGAGGAAGGAGAACCTTTCTCCGCTGAAGAATTG
GATGCTATGTGGCCTGTGGCAATTGATCCCATTACTGGACACATTCCCTA
CACCTTCTACATAAATCAACTCAGGCACAAGCCTGATATCTATGAAATTG
CCGAGGTTATCAAGGAGGAACTAGCACAAGCCGAAAAAGAAAAGGGCAAG
AAACCACAACAACCACTGTTTTAGATGCCCCTTTAATCAAGCAATTGCAA
ATAACGCGGAAAATAAATTTATACATTTTATAACAAATAAAAAAAAAAAA
AAAAAAAAAA

IP07479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9406-RA 724 CG9406-RA 41..724 1..684 3420 100 Plus
Magi-RA 5307 Magi-RA 76..151 76..1 380 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17029016..17029254 76..314 1180 99.6 Plus
chr2R 21145070 chr2R 17029307..17029517 315..525 995 98.1 Plus
chr2R 21145070 chr2R 17029569..17029732 525..688 790 98.8 Plus
chr2R 21145070 chr2R 17028877..17028958 1..76 285 92.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21142545..21142783 76..314 1195 100 Plus
2R 25286936 2R 21142836..21143046 315..525 1055 100 Plus
2R 25286936 2R 21143098..21143263 525..690 830 100 Plus
2R 25286936 2R 21142412..21142487 1..76 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21143744..21143982 76..314 1195 100 Plus
2R 25260384 2R 21144035..21144245 315..525 1055 100 Plus
2R 25260384 2R 21144297..21144462 525..690 830 100 Plus
2R 25260384 2R 21143611..21143686 1..76 380 100 Plus
Blast to na_te.dros performed 2019-03-16 09:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2633..2680 58..11 114 70.8 Minus

IP07479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:46:55 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17028877..17028958 1..76 92 -> Plus
chr2R 17029017..17029254 77..314 99 -> Plus
chr2R 17029307..17029517 315..525 98 -> Plus
chr2R 17029570..17029732 526..688 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:36 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..561 64..624 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:14 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..561 64..624 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:36 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..561 64..624 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:01 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..561 64..624 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:09 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..561 64..624 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:36 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..593 32..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:14 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 45..732 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:36 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 45..732 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:01 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 1..593 32..624 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:09 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
CG9406-RA 45..732 1..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:55 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21142412..21142487 1..76 100 -> Plus
2R 21142546..21142783 77..314 100 -> Plus
2R 21142836..21143046 315..525 100 -> Plus
2R 21143099..21143261 526..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:55 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21142412..21142487 1..76 100 -> Plus
2R 21142546..21142783 77..314 100 -> Plus
2R 21142836..21143046 315..525 100 -> Plus
2R 21143099..21143261 526..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:55 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21142412..21142487 1..76 100 -> Plus
2R 21142546..21142783 77..314 100 -> Plus
2R 21142836..21143046 315..525 100 -> Plus
2R 21143099..21143261 526..688 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:36 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17029917..17029992 1..76 100 -> Plus
arm_2R 17030051..17030288 77..314 100 -> Plus
arm_2R 17030341..17030551 315..525 100 -> Plus
arm_2R 17030604..17030766 526..688 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:24 Download gff for IP07479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21143745..21143982 77..314 100 -> Plus
2R 21144035..21144245 315..525 100 -> Plus
2R 21144298..21144460 526..688 100   Plus
2R 21143611..21143686 1..76 100 -> Plus

IP07479.pep Sequence

Translation from 63 to 623

> IP07479.pep
MEVGVTLNNELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKE
VEDVIKATDSVDYPGEAHLVKFMEHVSKLLMDRQMEPASSEKLLEAFETL
DPENKKYLTKEYFGKLMAEEGEPFSAEELDAMWPVAIDPITGHIPYTFYI
NQLRHKPDIYEIAEVIKEELAQAEKEKGKKPQQPLF*

IP07479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12975-PA 190 GF12975-PA 1..166 1..166 736 80.1 Plus
Dana\GF11744-PA 155 GF11744-PA 5..151 7..153 575 70.1 Plus
Dana\GF12835-PA 149 GF12835-PA 7..149 12..156 166 30.9 Plus
Dana\GF13647-PA 148 GF13647-PA 4..145 7..153 145 30.6 Plus
Dana\GF16772-PA 148 GF16772-PA 14..148 17..156 138 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22090-PA 186 GG22090-PA 1..186 1..186 931 93.5 Plus
Dere\GG22012-PA 219 GG22012-PA 5..151 7..153 575 70.1 Plus
Dere\GG20265-PA 149 GG20265-PA 7..149 12..156 166 30.9 Plus
Dere\GG11425-PA 148 GG11425-PA 6..148 12..156 137 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20721-PA 191 GH20721-PA 1..188 1..184 710 69.7 Plus
Dgri\GH23029-PA 155 GH23029-PA 5..151 7..153 539 66.7 Plus
Dgri\GH23405-PA 151 GH23405-PA 9..151 12..156 149 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9406-PA 186 CG9406-PA 1..186 1..186 972 100 Plus
CG11041-PB 155 CG11041-PB 5..151 7..153 569 70.1 Plus
Cam-PD 149 CG8472-PD 5..149 7..156 163 28.7 Plus
Cam-PC 149 CG8472-PC 5..149 7..156 163 28.7 Plus
Cam-PE 149 CG8472-PE 5..149 7..156 163 28.7 Plus
Cam-PB 149 CG8472-PB 5..149 7..156 163 28.7 Plus
Cam-PA 149 CG8472-PA 5..149 7..156 163 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20806-PA 188 GI20806-PA 1..182 3..185 700 72.1 Plus
Dmoj\GI21100-PA 155 GI21100-PA 5..151 7..153 550 68 Plus
Dmoj\GI20594-PA 149 GI20594-PA 7..149 12..156 166 30.9 Plus
Dmoj\GI10339-PA 149 GI10339-PA 7..149 12..156 148 29.1 Plus
Dmoj\GI19794-PA 151 GI19794-PA 7..151 6..155 136 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10155-PA 181 GL10155-PA 1..180 1..180 650 71.7 Plus
Dper\GL10367-PA 155 GL10367-PA 5..151 7..153 571 69.4 Plus
Dper\GL10814-PA 149 GL10814-PA 7..149 12..156 166 30.9 Plus
Dper\GL21535-PA 148 GL21535-PA 6..147 12..152 151 31.3 Plus
Dper\GL21536-PA 148 GL21536-PA 6..147 12..152 150 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25097-PB 181 GA25097-PB 1..180 1..180 651 72.2 Plus
Dpse\GA10723-PA 155 GA10723-PA 5..151 7..153 566 68.7 Plus
Dpse\GA24499-PA 149 GA24499-PA 7..149 12..156 166 30.9 Plus
Dpse\GA14657-PA 148 GA14657-PA 6..147 12..152 151 31.3 Plus
Dpse\GA26322-PA 148 GA26322-PA 6..147 12..152 150 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15808-PA 186 GM15808-PA 1..186 1..186 971 97.8 Plus
Dsec\GM21992-PA 215 GM21992-PA 5..151 7..153 572 69.4 Plus
Dsec\GM21351-PA 149 GM21351-PA 7..149 12..156 166 30.9 Plus
Dsec\GM10265-PA 148 GM10265-PA 6..148 12..156 138 30.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11566-PA 148 GD11566-PA 5..148 43..186 725 95.8 Plus
Dsim\GD11492-PA 168 GD11492-PA 49..164 7..153 421 55.8 Plus
Dsim\GD10849-PA 149 GD10849-PA 7..149 12..156 166 30.9 Plus
Dsim\GD21235-PA 148 GD21235-PA 6..148 12..156 138 30.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20947-PA 155 GJ20947-PA 5..151 7..153 544 67.3 Plus
Dvir\GJ20539-PA 113 GJ20539-PA 1..112 73..185 400 67.3 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 17..151 17..156 166 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20977-PA 182 GK20977-PA 1..178 5..182 593 70.2 Plus
Dwil\GK15902-PA 155 GK15902-PA 5..151 7..153 563 67.3 Plus
Dwil\GK22183-PA 149 GK22183-PA 7..149 12..156 166 30.9 Plus
Dwil\GK18988-PA 148 GK18988-PA 6..148 12..156 157 30.4 Plus
Dwil\GK21975-PA 147 GK21975-PA 4..147 7..155 138 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12170-PA 189 GE12170-PA 1..186 1..186 919 91.9 Plus
Dyak\GE12090-PA 227 GE12090-PA 5..151 7..153 574 70.1 Plus
Dyak\Cam-PA 149 GE12425-PA 7..149 12..156 166 30.9 Plus
Dyak\GE19162-PA 147 GE19162-PA 10..147 13..155 137 28 Plus
Dyak\GE23620-PA 148 GE23620-PA 6..148 12..156 136 30.2 Plus

IP07479.hyp Sequence

Translation from 63 to 623

> IP07479.hyp
MEVGVTLNNELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKE
VEDVIKATDSVDYPGEAHLVKFMEHVSKLLMDRQMEPASSEKLLEAFETL
DPENKKYLTKEYFGKLMAEEGEPFSAEELDAMWPVAIDPITGHIPYTFYI
NQLRHKPDIYEIAEVIKEELAQAEKEKGKKPQQPLF*

IP07479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9406-PA 186 CG9406-PA 1..186 1..186 972 100 Plus
CG11041-PB 155 CG11041-PB 5..151 7..153 569 70.1 Plus
Cam-PD 149 CG8472-PD 5..149 7..156 163 28.7 Plus
Cam-PC 149 CG8472-PC 5..149 7..156 163 28.7 Plus
Cam-PE 149 CG8472-PE 5..149 7..156 163 28.7 Plus