Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP07510.complete Sequence
563 bp (563 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022860
> IP07510.complete
ATAGGAAATTATTTGATTAGATTTTGGCAGTGTTTGAAATGAGCAACAAG
AAATCAAAGTTGGTGCAATCGCTGGAGGAGTCGACGCCGCCCATCGATGA
AGAGGACGTCATCCGCTTGATTGCTGACCAAATTCGCCAGCCTACGAGCG
ATCCAGTTGATATTAATTTAAGCAACAAGGAGAATCTAAGCATTCTGCAT
CTCGAGGATGCCTTTAAATTCAAAAATTCGATGCAAAGCTTTCACGTGTC
GCCCACTGCTGAATCCTTAAACGAAGTCATGCCAGTGAAGGACGAGGATC
TGGGCGAGATGCTGGATGCCCTGACCGACGTGATCCTGGTTGAGGAAGAC
GATGAGGACGATGGCGATGATGATGATTATGAAGAAGAAGAGGAAGATGG
TGACGACGAAGAGAATGAATTCGATGAAGAGGACGCGGATGATGTCGACG
AAAATGCTCCAAAAGCGAACTTAAATTCAGGCTGGATATTTTAAAAAACT
GATTTTCAGATGTATAACAATAATTAAATTTTAAGTTCAATATTAAAAAA
AAAAAAAAAAAAA
IP07510.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:22:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31806-RA | 530 | CG31806-RA | 1..530 | 15..544 | 2650 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:51:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 16983672..16984215 | 1..544 | 2705 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:51:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16985040..16985585 | 1..546 | 2730 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16985040..16985585 | 1..546 | 2730 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 15:51:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
opus | 7521 | opus OPUS 7521bp | 1596..1694 | 297..392 | 126 | 64 | Plus |
IP07510.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:52:25 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 16983672..16984018 | 1..347 | 100 | == | Plus |
chr2L | 16984081..16984215 | 410..544 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:39 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..456 | 39..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:39:30 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..456 | 39..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:56:11 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..456 | 39..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:14:55 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..456 | 39..494 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:43 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..456 | 39..494 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:11:42 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..530 | 15..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:39:30 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..530 | 15..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:56:11 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 63..606 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:14:55 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 1..530 | 15..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:43 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31806-RA | 63..606 | 1..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:25 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16985040..16985583 | 1..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:25 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16985040..16985583 | 1..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:25 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16985040..16985583 | 1..544 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:56:11 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16985040..16985583 | 1..544 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:13 Download gff for
IP07510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16985040..16985583 | 1..544 | 100 | | Plus |
IP07510.hyp Sequence
Translation from 38 to 493
> IP07510.hyp
MSNKKSKLVQSLEESTPPIDEEDVIRLIADQIRQPTSDPVDINLSNKENL
SILHLEDAFKFKNSMQSFHVSPTAESLNEVMPVKDEDLGEMLDALTDVIL
VEEDDEDDGDDDDYEEEEEDGDDEENEFDEEDADDVDENAPKANLNSGWI
F*
IP07510.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31806-PB | 151 | CG31806-PB | 1..151 | 1..151 | 779 | 100 | Plus |
CG31806-PA | 151 | CG31806-PA | 1..151 | 1..151 | 779 | 100 | Plus |
IP07510.pep Sequence
Translation from 38 to 493
> IP07510.pep
MSNKKSKLVQSLEESTPPIDEEDVIRLIADQIRQPTSDPVDINLSNKENL
SILHLEDAFKFKNSMQSFHVSPTAESLNEVMPVKDEDLGEMLDALTDVIL
VEEDDEDDGDDDDYEEEEEDGDDEENEFDEEDADDVDENAPKANLNSGWI
F*
IP07510.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:35:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14781-PA | 460 | GF14781-PA | 62..152 | 9..95 | 262 | 58.2 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:35:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH11698-PA | 463 | GH11698-PA | 63..154 | 4..93 | 151 | 35.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31806-PB | 151 | CG31806-PB | 1..151 | 1..151 | 779 | 100 | Plus |
CG31806-PA | 151 | CG31806-PA | 1..151 | 1..151 | 779 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:35:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16491-PB | 153 | GA16491-PB | 2..101 | 1..98 | 273 | 53 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:35:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17222-PA | 493 | GM17222-PA | 71..170 | 1..100 | 502 | 97 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:35:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24097-PA | 499 | GD24097-PA | 70..205 | 1..136 | 492 | 94.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:35:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK23794-PA | 489 | GK23794-PA | 62..155 | 9..98 | 146 | 38.9 | Plus |