Clone IP07551 Report

Search the DGRC for IP07551

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:75
Well:51
Vector:pOT2
Associated Gene/TranscriptFer3HCH-RA
Protein status:IP07551.pep: gold
Preliminary Size:561
Sequenced Size:772

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4349 2005-01-01 Successful iPCR screen
Fer3HCH 2008-04-29 Release 5.5 accounting
Fer3HCH 2008-08-15 Release 5.9 accounting
Fer3HCH 2008-12-18 5.12 accounting

Clone Sequence Records

IP07551.complete Sequence

772 bp (772 high quality bases) assembled on 2006-02-24

GenBank Submission: BT025000

> IP07551.complete
CTGTGCTGGGTTTCAATTCCAAATTGTATAGGTTTCTAAATTTTCAAAAA
CAAAAAAAAAAAAAAAAGATAGAAAAAAACTCAAAAAGAAGCAAAAGACA
TGGCGTGGTGCTTCCGCGACATTCGGCGCCACATGTGCATGCTGGTGCGT
CAGAACTTCGCCAAAAGTTGCGAGAAGAAGCTAAACGATCAGATCAACAT
GGAGTTGAAGGCATCCCACCAGTATCTGGCCATGGCCTACCATTTCGATC
GCTCCGATATCAGTTCACCCGGAATGCATCGATTCTTCCTAAAGGCGAGC
GTCGAGGAGCGGGAGCACGCGGAGAAGATCATGACGTACATGAACAAGCG
TGGTGGTCTAATCATTTTGAGCAGTGTACCACAGCCGTTGCCCTGTTTCG
CCAGCACCTTGGATGCACTAAAGCACGCAATGAAAATGGAACTGGAGGTC
AATAAGCATCTGCTCGATTTGCACGCCCTGGCTGGCAAGGAAGCGGATCC
GAATCTCTGCGATTTCATCGAGGCCAATTTCCTGCAGGAGCAAGTGGATG
GCCAGAAGATTCTGGCCGACTATATTAGCCAATTGGAGAAGGCACAAAAC
CAGGTGGGCGAATTCCTGTTCGACAAGTATATGGGCAGCGGCATGCATCC
TGCGAAATGAATACCTCAAAATGGACAACCATCCGATGAAGAATACGTAT
TATAATTGGCAAACCCATGTGTGTTCAGTAAAGATTCGTTTTTTGGCCGA
TCAAAAAAAAAAAAAAAAAAAA

IP07551.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3HCH-RA 752 Fer3HCH-RA 10..752 11..753 3715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12998299..12998817 752..234 2580 99.8 Minus
chrX 22417052 chrX 12998880..12999104 235..11 1125 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13107380..13107900 754..234 2605 100 Minus
X 23542271 X 13107961..13108185 235..11 1125 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13115478..13115998 754..234 2605 100 Minus
X 23527363 X 13116059..13116283 235..11 1125 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:58:22 has no hits.

IP07551.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:26 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12998299..12998816 235..752 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:16:02 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:03:48 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:29 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:47 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:40 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:16:02 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..751 2..752 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:03:48 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..751 2..752 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:29 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..561 100..660 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:47 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3HCH-RA 1..751 2..752 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:26 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
X 13107382..13107899 235..752 100 <- Minus
X 13107962..13108194 2..234 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:26 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
X 13107382..13107899 235..752 100 <- Minus
X 13107962..13108194 2..234 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:26 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
X 13107382..13107899 235..752 100 <- Minus
X 13107962..13108194 2..234 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:03:48 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13001415..13001932 235..752 100 <- Minus
arm_X 13001995..13002227 2..234 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:36:03 Download gff for IP07551.complete
Subject Subject Range Query Range Percent Splice Strand
X 13115480..13115997 235..752 100 <- Minus
X 13116060..13116292 2..234 98   Minus

IP07551.pep Sequence

Translation from 99 to 659

> IP07551.pep
MAWCFRDIRRHMCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFD
RSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPCF
ASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVD
GQKILADYISQLEKAQNQVGEFLFDKYMGSGMHPAK*

IP07551.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20872-PA 189 GF20872-PA 11..189 10..186 797 81 Plus
Dana\GF16185-PA 205 GF16185-PA 39..203 22..176 209 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19524-PA 189 GG19524-PA 1..185 1..185 910 89.7 Plus
Dere\GG11946-PA 205 GG11946-PA 40..205 23..178 233 35.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24547-PA 190 GH24547-PA 11..185 10..183 717 75.4 Plus
Dgri\GH18415-PA 212 GH18415-PA 45..212 24..178 275 38.7 Plus
Dgri\GH19160-PA 225 GH19160-PA 54..222 25..178 159 24.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3HCH-PA 186 CG4349-PA 1..186 1..186 979 100 Plus
Fer1HCH-PJ 169 CG2216-PJ 4..167 23..176 225 35.5 Plus
Fer1HCH-PD 205 CG2216-PD 40..203 23..176 225 35.5 Plus
Fer1HCH-PC 205 CG2216-PC 40..203 23..176 225 35.5 Plus
Fer1HCH-PB 205 CG2216-PB 40..203 23..176 225 35.5 Plus
Fer1HCH-PA 205 CG2216-PA 40..203 23..176 225 35.5 Plus
Fer1HCH-PG 242 CG2216-PG 77..240 23..176 225 35.5 Plus
Fer1HCH-PF 242 CG2216-PF 77..240 23..176 225 35.5 Plus
Fer1HCH-PI 245 CG2216-PI 80..243 23..176 225 35.5 Plus
Fer1HCH-PE 121 CG2216-PE 40..104 23..87 156 44.6 Plus
Fer2LCH-PD 227 CG1469-PD 55..224 25..178 142 24.1 Plus
Fer2LCH-PC 227 CG1469-PC 55..224 25..178 142 24.1 Plus
Fer2LCH-PB 227 CG1469-PB 55..224 25..178 142 24.1 Plus
Fer2LCH-PA 227 CG1469-PA 55..224 25..178 142 24.1 Plus
Fer2LCH-PE 236 CG1469-PE 64..233 25..178 142 24.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16260-PA 190 GI16260-PA 10..184 10..183 726 76 Plus
Dmoj\GI24318-PA 194 GI24318-PA 27..194 24..178 267 39.1 Plus
Dmoj\GI23266-PA 225 GI23266-PA 54..222 25..178 164 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16490-PA 194 GL16490-PA 10..188 9..185 771 77.1 Plus
Dper\GL14055-PA 206 GL14055-PA 41..204 23..176 213 34.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22605-PA 273 GA22605-PA 89..267 9..185 776 78.2 Plus
Dpse\GA15307-PC 206 GA15307-PC 41..204 23..176 213 34.3 Plus
Dpse\GA15307-PB 206 GA15307-PB 41..204 23..176 213 34.3 Plus
Dpse\GA15307-PA 206 GA15307-PA 41..204 23..176 213 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11516-PA 186 GM11516-PA 1..186 1..186 984 97.8 Plus
Dsec\GM12162-PA 205 GM12162-PA 40..205 23..178 234 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15908-PA 186 GD15908-PA 1..186 1..186 979 97.3 Plus
Dsim\GD17157-PA 205 GD17157-PA 40..205 23..178 232 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16902-PA 193 GJ16902-PA 1..181 1..181 759 76.8 Plus
Dvir\GJ10402-PA 212 GJ10402-PA 45..210 24..176 275 41 Plus
Dvir\GJ10765-PA 225 GJ10765-PA 54..222 25..178 169 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25020-PA 202 GK25020-PA 13..185 9..181 743 77.5 Plus
Dwil\GK13135-PA 245 GK13135-PA 80..243 23..176 216 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16178-PA 186 GE16178-PA 1..186 1..186 902 87.6 Plus
Dyak\Fer1HCH-PA 205 GE23394-PA 40..205 23..178 236 35.1 Plus

IP07551.hyp Sequence

Translation from 99 to 659

> IP07551.hyp
MAWCFRDIRRHMCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFD
RSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPCF
ASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVD
GQKILADYISQLEKAQNQVGEFLFDKYMGSGMHPAK*

IP07551.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3HCH-PA 186 CG4349-PA 1..186 1..186 979 100 Plus
Fer1HCH-PJ 169 CG2216-PJ 4..167 23..176 225 35.5 Plus
Fer1HCH-PD 205 CG2216-PD 40..203 23..176 225 35.5 Plus
Fer1HCH-PC 205 CG2216-PC 40..203 23..176 225 35.5 Plus
Fer1HCH-PB 205 CG2216-PB 40..203 23..176 225 35.5 Plus