Clone IP07569 Report

Search the DGRC for IP07569

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:75
Well:69
Vector:pOT2
Associated Gene/TranscriptCG8407-RA
Protein status:IP07569.pep: gold
Preliminary Size:523
Sequenced Size:629

Clone Sequence Records

IP07569.complete Sequence

629 bp assembled on 2009-02-17

GenBank Submission: BT056268.1

> IP07569.complete
TAAATAGGAATTTAACTCGATTTTTATTACATTAGCGTGGCTCCGTGATA
GTGCTCGCTCGCCTGGGTGATAGTCCTTCCAACATTCGTTGGTGAATCGC
AGACATGGCAGACGAGGAGGCCGGCAAGGAGGGCGAGAAGAAAATCGTGC
ACGTTTATCCTCTGGTTAAGCACACCGATATGAACGAGGAGATGCGGATA
GAGGCCATTGAACTGTCCATTACCGCCTGCGAGAAATACTCATCGAACTA
CGAGCACGCTGCCAAAATCATCAAGGAGAACATGGACAAGAAGTTCGGCA
TCTACTGGCATGTGGTCGTGGGCGAAGGGTTCGGCTTTGAGGTCTCCTAC
GAGACGGAGAACATTCTTTATCTGTTCTTCGCCGGCAACCTGGCCATCGT
GCTGTGGAAGTGCTCCTGAATGCGGGTCAGCAGTGACACTAACGTACCTA
GAAACCGGAACTGGAACCAAAACCGAACCAAACAAAAATTTAGCATTAAT
TTTAGTCATACACACAGAACACTCACCGTAGTTAACGAATGTTATGAATA
TTAAGCCGCGCGGAGGCGGCGGAAATAAATCCCCTGGCAACCATGTGACT
TGTTGGGAAAAGAAAAAAAAAAAAAAAAA

IP07569.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-RA 909 CG8407-RA 299..909 1..611 3055 100 Plus
CG8407-RB 844 CG8407-RB 269..844 36..611 2880 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8041115..8041474 253..612 1755 99.2 Plus
chr2R 21145070 chr2R 8040606..8040775 1..170 835 99.4 Plus
chr2R 21145070 chr2R 8040837..8040925 166..254 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12153904..12154265 253..614 1810 100 Plus
2R 25286936 2R 12153409..12153578 1..170 850 100 Plus
2R 25286936 2R 12153640..12153728 166..254 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12155103..12155464 253..614 1810 100 Plus
2R 25260384 2R 12154608..12154777 1..170 850 100 Plus
2R 25260384 2R 12154839..12154927 166..254 445 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:49:17 has no hits.

IP07569.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:50:28 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8040606..8040775 1..170 99 -> Plus
chr2R 8040842..8040925 171..254 100 -> Plus
chr2R 8041117..8041474 255..612 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:38 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..315 105..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:46 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RB 1..315 105..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:23:48 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..315 105..419 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:16 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..315 105..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-17 14:09:52 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..523 53..575 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:46 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RB 146..727 27..611 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:23:48 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..612 1..612 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:16 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 1..612 1..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:28 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12153645..12153728 171..254 100 -> Plus
2R 12153409..12153578 1..170 100 -> Plus
2R 12153906..12154263 255..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:28 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12153645..12153728 171..254 100 -> Plus
2R 12153409..12153578 1..170 100 -> Plus
2R 12153906..12154263 255..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:28 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12153645..12153728 171..254 100 -> Plus
2R 12153409..12153578 1..170 100 -> Plus
2R 12153906..12154263 255..612 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:23:48 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8040914..8041083 1..170 100 -> Plus
arm_2R 8041150..8041233 171..254 100 -> Plus
arm_2R 8041411..8041768 255..612 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:06 Download gff for IP07569.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12155105..12155462 255..612 100   Plus
2R 12154608..12154777 1..170 100 -> Plus
2R 12154844..12154927 171..254 100 -> Plus

IP07569.hyp Sequence

Translation from 104 to 418

> IP07569.hyp
MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYE
HAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVL
WKCS*

IP07569.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-PB 104 CG8407-PB 1..104 1..104 550 100 Plus
CG8407-PA 104 CG8407-PA 1..104 1..104 550 100 Plus
Cdlc2-PC 89 CG5450-PC 7..87 20..102 168 41 Plus
Cdlc2-PB 89 CG5450-PB 7..87 20..102 168 41 Plus
Cdlc2-PA 89 CG5450-PA 7..87 20..102 168 41 Plus

IP07569.pep Sequence

Translation from 104 to 418

> IP07569.pep
MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYE
HAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVL
WKCS*

IP07569.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12295-PA 105 GF12295-PA 1..105 1..104 496 90.5 Plus
Dana\GF15181-PA 89 GF15181-PA 7..87 20..102 159 41 Plus
Dana\GF22273-PA 211 GF22273-PA 7..78 20..92 144 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20249-PA 104 GG20249-PA 1..104 1..104 536 99 Plus
Dere\GG24601-PA 89 GG24601-PA 7..87 20..102 161 41 Plus
Dere\GG24789-PA 89 GG24789-PA 7..87 20..102 161 41 Plus
Dere\GG18720-PA 89 GG18720-PA 7..87 20..102 160 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19716-PA 104 GH19716-PA 1..104 1..104 455 81.7 Plus
Dgri\GH11410-PA 89 GH11410-PA 7..87 20..102 160 42.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-PB 104 CG8407-PB 1..104 1..104 550 100 Plus
CG8407-PA 104 CG8407-PA 1..104 1..104 550 100 Plus
Cdlc2-PC 89 CG5450-PC 7..87 20..102 168 41 Plus
Cdlc2-PB 89 CG5450-PB 7..87 20..102 168 41 Plus
Cdlc2-PA 89 CG5450-PA 7..87 20..102 168 41 Plus
ctp-PE 89 CG6998-PE 7..87 20..102 167 42.2 Plus
ctp-PC 89 CG6998-PC 7..87 20..102 167 42.2 Plus
ctp-PA 89 CG6998-PA 7..87 20..102 167 42.2 Plus
ctp-PB 89 CG6998-PB 7..87 20..102 167 42.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20135-PA 104 GI20135-PA 1..104 1..104 445 77.9 Plus
Dmoj\GI14563-PA 89 GI14563-PA 7..87 20..102 160 42.2 Plus
Dmoj\GI14559-PA 89 GI14559-PA 7..87 20..102 157 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11080-PA 105 GL11080-PA 15..105 14..104 457 94.5 Plus
Dper\GL15652-PA 89 GL15652-PA 7..88 20..103 169 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21054-PA 105 GA21054-PA 15..105 14..104 457 94.5 Plus
Dpse\GA26073-PA 89 GA26073-PA 7..88 20..103 169 42.9 Plus
Dpse\GA25980-PA 89 GA25980-PA 7..87 20..102 160 42.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21336-PA 104 GM21336-PA 1..104 1..104 539 99 Plus
Dsec\GM16816-PA 89 GM16816-PA 7..87 20..102 161 41 Plus
Dsec\GM12359-PA 89 GM12359-PA 7..87 20..102 160 42.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15399-PA 104 GD15399-PA 1..104 1..104 539 99 Plus
Dsim\GD15397-PA 104 GD15397-PA 1..104 1..104 539 99 Plus
Dsim\GD23096-PA 89 GD23096-PA 7..87 20..102 161 41 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19905-PA 104 GJ19905-PA 1..104 1..104 479 85.6 Plus
Dvir\GJ17036-PA 89 GJ17036-PA 7..87 20..102 160 42.2 Plus
Dvir\GJ17025-PA 89 GJ17025-PA 7..87 20..102 156 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23006-PA 105 GK23006-PA 15..105 14..104 460 95.6 Plus
Dwil\GK25335-PA 268 GK25335-PA 7..87 20..102 163 42.2 Plus
Dwil\GK15188-PA 89 GK15188-PA 7..87 20..102 160 42.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12408-PA 104 GE12408-PA 1..104 1..104 536 99 Plus
Dyak\GE17560-PA 89 GE17560-PA 7..87 20..102 161 41 Plus
Dyak\ctp-PA 89 GE16358-PA 7..87 20..102 160 42.2 Plus