Clone IP07628 Report

Search the DGRC for IP07628

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:28
Vector:pOT2
Associated Gene/TranscriptCG12420-RA
Protein status:IP07628.pep: gold
Preliminary Size:723
Sequenced Size:857

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12420 2005-01-01 Successful iPCR screen
CG12420 2008-04-29 Release 5.5 accounting
CG12420 2008-08-15 Release 5.9 accounting
CG12420 2008-12-18 5.12 accounting

Clone Sequence Records

IP07628.complete Sequence

857 bp (857 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022703

> IP07628.complete
CGACACATTCGATTCAGACCGACTGACAATCACGCGATCTTTAAGATGGC
ACAACCAGGCGGAGATCACATGATCATCGCTATCACCACACTGTTGGTTT
TGATCTGTTCCCTACATCTCGCCAATGCAGCCAGCTATCAGCTACAATCT
TACGATCTTGATACGGATAATAGGGCTGCATCGAACTCCAGCGAGGAGGT
GTTCAATGGCGGAGTCACGTCCCTGGAAAGACCTCTTTCTTGGCTGCGGA
ATGCCAACAGCGTGTTCGGCAGTCCCGCTGGTCATGTGGTCATCCAGGTG
GCCAAGGAGCTGTTACATCGATCAGCCGGAAACAGTCAAGTTCTAAGTCT
GAATCTGACCAACCTGCTTATCATCATACTCCTGAAAATACTTATCTTCT
CAGCCGGAATGCTGGGCGCTGGGCACTGGAGTGGCTATGGTTATGGACAT
GGTCGCTCAGCCGGTCGTAGTGATAACTTCGGTTTGGGCATAGCTTCTGG
CGATGACTATCTTATAACCGGATTTCTCGCCGCCCAAGGAGCCGGCAGAG
ATGAGTGCCTCTATGCAGCATCCTGTGCCTGCCCCACATCGGCCTATGAG
TACGCGAAAGCAGGACGTGCTCTTATGGGCGCCATTGAAGTTTTCCAAGG
AGTGCCGCTGGAGAAGCCGCGCTACAACGACCTCATCGTCCTGATGGAGC
GAGCCGCCTACGATGGCTTCCGAGGAGTGGCCTGCAACACGACCCAGACC
TGTGACGGATTGCTTTAAAGATTCCAAAGCAAAATGCACTCTTATTTATG
TATCTATTAAAATGTATATTAAATCATTAGGTTGTATTACAAAAAAAAAA
AAAAAAA

IP07628.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12420.b 1219 CG12420.b 380..1219 1..840 4200 100 Plus
CG12420.a 1052 CG12420.a 213..1052 1..840 4200 100 Plus
CG12420-RA 1219 CG12420-RA 380..1219 1..840 4200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6048443..6048783 1..341 1705 100 Plus
chr3R 27901430 chr3R 6048846..6049156 340..650 1555 100 Plus
chr3R 27901430 chr3R 6049285..6049475 650..840 955 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10222713..10223053 1..341 1705 100 Plus
3R 32079331 3R 10223116..10223426 340..650 1555 100 Plus
3R 32079331 3R 10223555..10223748 650..843 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9963544..9963884 1..341 1705 100 Plus
3R 31820162 3R 9963947..9964257 340..650 1555 100 Plus
3R 31820162 3R 9964386..9964579 650..843 970 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:20:49 has no hits.

IP07628.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:22:54 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6048443..6048781 1..339 100 -> Plus
chr3R 6048846..6049156 340..650 100 -> Plus
chr3R 6049286..6049475 651..840 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:52 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..723 46..768 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:14 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..723 46..768 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:21 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..723 46..768 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:01 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..723 46..768 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:12:35 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..723 46..768 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:55 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..840 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:14 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..840 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:21 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 16..855 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:01 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 1..840 1..840 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:35 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
CG12420-RA 16..855 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:54 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10223556..10223745 651..840 100   Plus
3R 10222713..10223051 1..339 100 -> Plus
3R 10223116..10223426 340..650 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:54 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10223556..10223745 651..840 100   Plus
3R 10222713..10223051 1..339 100 -> Plus
3R 10223116..10223426 340..650 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:54 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10223556..10223745 651..840 100   Plus
3R 10222713..10223051 1..339 100 -> Plus
3R 10223116..10223426 340..650 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:21 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6048435..6048773 1..339 100 -> Plus
arm_3R 6049278..6049467 651..840 100   Plus
arm_3R 6048838..6049148 340..650 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:13 Download gff for IP07628.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9963544..9963882 1..339 100 -> Plus
3R 9963947..9964257 340..650 100 -> Plus
3R 9964387..9964576 651..840 100   Plus

IP07628.pep Sequence

Translation from 0 to 767

> IP07628.pep
RHIRFRPTDNHAIFKMAQPGGDHMIIAITTLLVLICSLHLANAASYQLQS
YDLDTDNRAASNSSEEVFNGGVTSLERPLSWLRNANSVFGSPAGHVVIQV
AKELLHRSAGNSQVLSLNLTNLLIIILLKILIFSAGMLGAGHWSGYGYGH
GRSAGRSDNFGLGIASGDDYLITGFLAAQGAGRDECLYAASCACPTSAYE
YAKAGRALMGAIEVFQGVPLEKPRYNDLIVLMERAAYDGFRGVACNTTQT
CDGLL*

IP07628.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17455-PA 241 GF17455-PA 1..241 16..255 830 74.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17467-PA 242 GG17467-PA 1..242 16..255 1066 90.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19117-PA 234 GH19117-PA 16..234 30..255 693 67.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12420-PA 240 CG12420-PA 1..240 16..255 1237 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23572-PA 226 GI23572-PA 9..226 26..255 692 70.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23682-PA 240 GL23682-PA 1..240 16..255 807 76.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11623-PA 240 GA11623-PA 1..240 16..255 802 75.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23868-PA 240 GM23868-PA 1..240 16..255 1198 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18675-PA 440 GD18675-PA 1..200 16..215 862 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23547-PA 238 GJ23547-PA 29..238 38..255 691 70.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22631-PA 227 GK22631-PA 8..227 32..255 756 69.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26017-PA 240 GE26017-PA 1..240 16..255 1079 93.3 Plus

IP07628.hyp Sequence

Translation from 0 to 767

> IP07628.hyp
RHIRFRPTDNHAIFKMAQPGGDHMIIAITTLLVLICSLHLANAASYQLQS
YDLDTDNRAASNSSEEVFNGGVTSLERPLSWLRNANSVFGSPAGHVVIQV
AKELLHRSAGNSQVLSLNLTNLLIIILLKILIFSAGMLGAGHWSGYGYGH
GRSAGRSDNFGLGIASGDDYLITGFLAAQGAGRDECLYAASCACPTSAYE
YAKAGRALMGAIEVFQGVPLEKPRYNDLIVLMERAAYDGFRGVACNTTQT
CDGLL*

IP07628.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12420-PA 240 CG12420-PA 1..240 16..255 1237 100 Plus