BDGP Sequence Production Resources |
Search the DGRC for IP07638
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 76 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34107-RA |
Protein status: | IP07638.pep: gold |
Preliminary Size: | 666 |
Sequenced Size: | 622 |
Gene | Date | Evidence |
---|---|---|
CG34107 | 2008-04-29 | Release 5.5 accounting |
CG34107 | 2008-08-15 | Release 5.9 accounting |
CG34107 | 2008-12-18 | 5.12 accounting |
622 bp (622 high quality bases) assembled on 2005-06-08
GenBank Submission: BT023597
> IP07638.complete AGCAAACATCGCTTAAAACATTTACAAATTTTCAACAGTAAAAACAGGAA AATGTGCGAACAGTACTGTGACAAGTTTGAGACCTTCAATCCGGAGGTTG AGTTTGCCAAGTTTCAAAAACGCAAGCCTGTCGTAAGGACTGCCCAACTC TATGAGAATTTGCACAAGCGGGAGGATATCAAGTGTCCCTACAGCTTCAA AGGTTATGGCGTGGAGACGGATTCCAATACAATGTACCGCACTTGCAACT CCGAATATGGTTACTATGCACCCAATGCCTATACCATACCCAAGCGTTTC TATCCATTGCCCCAGAGTTTCTCCAATGAAGTCGTGCGTTTCGGCATGTA TCGCAATTTCTCCCTGAACACACATATGGATCGTACCTTCTATTAGGACA GCAAATCTCAATAGCCTCATATTGTTTTAAGGTTTATACACAATTTTACG ATTTCTTATGAAATTTGAAATTTTATTCTGGTCACCAAGTAACTGTATCA TTTATTCGAAACCCTTGCCTTAATAAGCAACCTTGAGCAAATCTATCAAT AACAAATTTAAAACTGTAAAACGGCATAAAAATAAAAAAAAAACATTTCG AAAAGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34107-RA | 737 | CG34107-RA | 132..737 | 1..607 | 2995 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Juan | 4236 | Juan JUAN 4236bp | 3034..3157 | 302..176 | 106 | 57.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 6050644..6050833 | 1..190 | 100 | -> | Plus |
chr3R | 6050902..6051316 | 191..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 1..345 | 52..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 1..345 | 52..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 1..345 | 52..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 1..345 | 52..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 1..345 | 52..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 7..611 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 7..611 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 7..611 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 7..611 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34107-RA | 7..611 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10224915..10225104 | 1..190 | 100 | -> | Plus |
3R | 10225173..10225587 | 191..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10224915..10225104 | 1..190 | 100 | -> | Plus |
3R | 10225173..10225587 | 191..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10224915..10225104 | 1..190 | 100 | -> | Plus |
3R | 10225173..10225587 | 191..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 6050637..6050826 | 1..190 | 100 | -> | Plus |
arm_3R | 6050895..6051309 | 191..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9966004..9966418 | 191..606 | 99 | Plus | |
3R | 9965746..9965935 | 1..190 | 100 | -> | Plus |
Translation from 0 to 395
> IP07638.hyp SKHRLKHLQIFNSKNRKMCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQL YENLHKREDIKCPYSFKGYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRF YPLPQSFSNEVVRFGMYRNFSLNTHMDRTFY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34107-PA | 114 | CG34107-PA | 1..114 | 18..131 | 634 | 100 | Plus |
Translation from 0 to 395
> IP07638.pep SKHRLKHLQIFNSKNRKMCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQL YENLHKREDIKCPYSFKGYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRF YPLPQSFSNEVVRFGMYRNFSLNTHMDRTFY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17456-PA | 226 | GF17456-PA | 1..99 | 18..116 | 524 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17477-PA | 220 | GG17477-PA | 1..99 | 18..116 | 538 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19118-PA | 228 | GH19118-PA | 1..109 | 18..126 | 469 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34107-PA | 114 | CG34107-PA | 1..114 | 18..131 | 634 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23573-PA | 224 | GI23573-PA | 1..99 | 18..116 | 453 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23683-PA | 275 | GL23683-PA | 1..99 | 18..116 | 455 | 81.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA30073-PB | 114 | GA30073-PB | 1..114 | 18..131 | 513 | 82.5 | Plus |
Dpse\GA29208-PA | 90 | GA29208-PA | 1..90 | 42..131 | 410 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23869-PA | 215 | GM23869-PA | 1..99 | 18..116 | 543 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18676-PA | 187 | GD18676-PA | 1..99 | 18..116 | 535 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23548-PA | 223 | GJ23548-PA | 1..99 | 18..116 | 470 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22632-PA | 229 | GK22632-PA | 1..99 | 18..116 | 479 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26018-PA | 220 | GE26018-PA | 1..99 | 18..116 | 539 | 97 | Plus |