Clone IP07638 Report

Search the DGRC for IP07638

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:38
Vector:pOT2
Associated Gene/TranscriptCG34107-RA
Protein status:IP07638.pep: gold
Preliminary Size:666
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34107 2008-04-29 Release 5.5 accounting
CG34107 2008-08-15 Release 5.9 accounting
CG34107 2008-12-18 5.12 accounting

Clone Sequence Records

IP07638.complete Sequence

622 bp (622 high quality bases) assembled on 2005-06-08

GenBank Submission: BT023597

> IP07638.complete
AGCAAACATCGCTTAAAACATTTACAAATTTTCAACAGTAAAAACAGGAA
AATGTGCGAACAGTACTGTGACAAGTTTGAGACCTTCAATCCGGAGGTTG
AGTTTGCCAAGTTTCAAAAACGCAAGCCTGTCGTAAGGACTGCCCAACTC
TATGAGAATTTGCACAAGCGGGAGGATATCAAGTGTCCCTACAGCTTCAA
AGGTTATGGCGTGGAGACGGATTCCAATACAATGTACCGCACTTGCAACT
CCGAATATGGTTACTATGCACCCAATGCCTATACCATACCCAAGCGTTTC
TATCCATTGCCCCAGAGTTTCTCCAATGAAGTCGTGCGTTTCGGCATGTA
TCGCAATTTCTCCCTGAACACACATATGGATCGTACCTTCTATTAGGACA
GCAAATCTCAATAGCCTCATATTGTTTTAAGGTTTATACACAATTTTACG
ATTTCTTATGAAATTTGAAATTTTATTCTGGTCACCAAGTAACTGTATCA
TTTATTCGAAACCCTTGCCTTAATAAGCAACCTTGAGCAAATCTATCAAT
AACAAATTTAAAACTGTAAAACGGCATAAAAATAAAAAAAAAACATTTCG
AAAAGCAAAAAAAAAAAAAAAA

IP07638.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-RA 737 CG34107-RA 132..737 1..607 2995 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6050902..6051316 191..606 2030 99.8 Plus
chr3R 27901430 chr3R 6050644..6050833 1..190 950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10225173..10225588 191..607 2035 99.8 Plus
3R 32079331 3R 10224915..10225104 1..190 950 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9966004..9966419 191..607 2045 99.7 Plus
3R 31820162 3R 9965746..9965935 1..190 950 100 Plus
Blast to na_te.dros performed 2019-03-16 13:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3034..3157 302..176 106 57.4 Minus

IP07638.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:13:19 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6050644..6050833 1..190 100 -> Plus
chr3R 6050902..6051316 191..606 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:53 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 1..345 52..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:27 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 1..345 52..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:49 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 1..345 52..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:41:57 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 1..345 52..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:29 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 1..345 52..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:45:07 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 7..611 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:27 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 7..611 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:49 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 7..611 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:41:58 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 7..611 1..606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:29 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 7..611 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:19 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224915..10225104 1..190 100 -> Plus
3R 10225173..10225587 191..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:19 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224915..10225104 1..190 100 -> Plus
3R 10225173..10225587 191..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:19 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224915..10225104 1..190 100 -> Plus
3R 10225173..10225587 191..606 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:49 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6050637..6050826 1..190 100 -> Plus
arm_3R 6050895..6051309 191..606 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:58 Download gff for IP07638.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9966004..9966418 191..606 99   Plus
3R 9965746..9965935 1..190 100 -> Plus

IP07638.hyp Sequence

Translation from 0 to 395

> IP07638.hyp
SKHRLKHLQIFNSKNRKMCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQL
YENLHKREDIKCPYSFKGYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRF
YPLPQSFSNEVVRFGMYRNFSLNTHMDRTFY*

IP07638.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-PA 114 CG34107-PA 1..114 18..131 634 100 Plus

IP07638.pep Sequence

Translation from 0 to 395

> IP07638.pep
SKHRLKHLQIFNSKNRKMCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQL
YENLHKREDIKCPYSFKGYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRF
YPLPQSFSNEVVRFGMYRNFSLNTHMDRTFY*

IP07638.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17456-PA 226 GF17456-PA 1..99 18..116 524 93.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17477-PA 220 GG17477-PA 1..99 18..116 538 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19118-PA 228 GH19118-PA 1..109 18..126 469 77.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-PA 114 CG34107-PA 1..114 18..131 634 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23573-PA 224 GI23573-PA 1..99 18..116 453 79.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23683-PA 275 GL23683-PA 1..99 18..116 455 81.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30073-PB 114 GA30073-PB 1..114 18..131 513 82.5 Plus
Dpse\GA29208-PA 90 GA29208-PA 1..90 42..131 410 83.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23869-PA 215 GM23869-PA 1..99 18..116 543 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18676-PA 187 GD18676-PA 1..99 18..116 535 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23548-PA 223 GJ23548-PA 1..99 18..116 470 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22632-PA 229 GK22632-PA 1..99 18..116 479 85.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26018-PA 220 GE26018-PA 1..99 18..116 539 97 Plus