Clone IP07647 Report

Search the DGRC for IP07647

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:47
Vector:pOT2
Associated Gene/TranscriptCG13133-RA
Protein status:IP07647.pep: gold
Preliminary Size:654
Sequenced Size:1231

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13133 2005-01-01 Successful iPCR screen
CG13133 2008-04-29 Release 5.5 accounting
CG13133 2008-08-15 Release 5.9 accounting
CG13133 2008-12-18 5.12 accounting

Clone Sequence Records

IP07647.complete Sequence

1231 bp (1231 high quality bases) assembled on 2006-04-12

GenBank Submission: BT025130

> IP07647.complete
CCAGGTACAGTTGTGCAGCTCCAAGTTCCAGCGATTACCATAACCTCATC
CACTCAGTTAGCTTGTAAGAGTCGAACCGGGCGGAGGGCAACGGTTTTTT
TGGCCACATAAGCCAAAAATCAACACGCTTGCTCCGTGTGTCCAACGAAC
CGGAGTCCGTGCATCGGGAACCGGTGGCGCAGTCATGCCCATCCACTGGG
ACTGGGATTGGGAGCATGATCACGAGCATGGTCACCATCACTGGCAACCG
CCGCGTCGCCACTGGTCCACCGGGGAGTCCAAGTGCCGGCAGAGGCACTA
CTATCTCTCCCACGACCTGGACGTATGTGCGCGGGACTTTCACTTGCGGA
TGGACGACAGTGCCTGGTGCCATGGATCCTGTCTGGTTGGGCGAGTGGTC
ATAGAGACCGGCACCGAACCGGACTCCCTGGGTCGGGGCACCTTCAAGGT
GGTGCTGGACGTGCACCACTTTCAGATCTCTGAGCTCACGGTGAAGGCCA
AAAACAGCGACACCGTGTGCGTGGAGGGCAAGCAGGCGGATGACCGGGCG
GAGAAGGGTCAGTTGTGCATCACTCGCGAGTTTACGCGATCCTACAAGCT
ACCACGGCACTACGATGCCACACAGGCACGGGCCACCTTCTCTGCGGACG
GAATACTGATGATTACGGTGCCAGCACCACCGAAACTGGACGACGTGGAG
CGCGAGATCGAGATTGAGCCCACGGGCAATTACTTTGGCAGCGTGTCCGA
TCCCACGGCGCCCAAGGCTATCGAGCAGGCGGATGTGGACGGCGATGGTG
GAGAGGCTAATCCTGCTGGCACGGCGATGGACAAATGAAGCCGGCGACGT
CTGGCGGTTGCGCGGCGGTTCCGCTTGCTCATACCAAAGTGGAGGCGGAA
GTCCAAATGCGTTTAGGCCGCCAGAGGCAGTCGATCGGTTGGAGGGCAGT
TGCAGTATATCAGACGGAGAGACAGTCGAAGCACATTCCAGTCACCTGGC
GCACATGCACGTTGGAGTTTTTCGTGGAAACCAAAATCACTCGGATTGTT
CCTGGGTTCCAGCTTAGATAGCACGTAGTCCTTCGTTCGAAACGTGAGCA
AATATGGCGAAGTCAACATTTTGTAGAATTTTCTTAAGGTAGCTTCAATA
TAACGTTTAAGAGTTCATATCCGCTTGTGATTTTGTTTAACGCCAATAAA
GGACTTTATCAGAAAAAAAAAAAAAAAAAAA

IP07647.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13133-RA 1212 CG13133-RA 1..1212 1..1212 6060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10090139..10091350 1212..1 6015 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10091204..10092419 1216..1 6080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10091204..10092419 1216..1 6080 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:05:57 has no hits.

IP07647.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:06:45 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10090139..10091350 1..1212 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:55 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:51:36 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:11 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:32:17 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:19:17 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:25:38 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..1212 1..1212 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:51:36 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..1212 1..1212 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:11 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..1182 31..1212 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:32:17 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..654 185..838 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:19:17 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
CG13133-RA 1..1182 31..1212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:45 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10091208..10092419 1..1212 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:45 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10091208..10092419 1..1212 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:45 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10091208..10092419 1..1212 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:11 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10091208..10092419 1..1212 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:10:49 Download gff for IP07647.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10091208..10092419 1..1212 100   Minus

IP07647.hyp Sequence

Translation from 184 to 837

> IP07647.hyp
MPIHWDWDWEHDHEHGHHHWQPPRRHWSTGESKCRQRHYYLSHDLDVCAR
DFHLRMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISE
LTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARA
TFSADGILMITVPAPPKLDDVEREIEIEPTGNYFGSVSDPTAPKAIEQAD
VDGDGGEANPAGTAMDK*

IP07647.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13133-PA 217 CG13133-PA 1..217 1..217 1209 100 Plus
Hsp27-PB 213 CG4466-PB 84..210 81..216 192 37.7 Plus
Hsp27-PA 213 CG4466-PA 84..210 81..216 192 37.7 Plus
Hsp23-PB 186 CG4463-PB 66..180 82..198 185 38.7 Plus
Hsp23-PA 186 CG4463-PA 66..180 82..198 185 38.7 Plus

IP07647.pep Sequence

Translation from 184 to 837

> IP07647.pep
MPIHWDWDWEHDHEHGHHHWQPPRRHWSTGESKCRQRHYYLSHDLDVCAR
DFHLRMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISE
LTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARA
TFSADGILMITVPAPPKLDDVEREIEIEPTGNYFGSVSDPTAPKAIEQAD
VDGDGGEANPAGTAMDK*

IP07647.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14138-PA 216 GF14138-PA 1..216 1..217 1030 90 Plus
Dana\GF10691-PA 190 GF10691-PA 66..189 82..207 195 36.7 Plus
Dana\GF23739-PA 205 GF23739-PA 81..179 82..181 163 35.3 Plus
Dana\GF10689-PA 174 GF10689-PA 56..157 79..181 157 36.2 Plus
Dana\GF11829-PA 187 GF11829-PA 79..171 87..181 150 37.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23981-PA 217 GG23981-PA 1..217 1..217 1141 96.8 Plus
Dere\GG15370-PA 187 GG15370-PA 66..181 81..198 191 39.2 Plus
Dere\GG15367-PA 173 GG15367-PA 56..157 79..181 184 40 Plus
Dere\GG14047-PA 208 GG14047-PA 84..182 82..181 173 38.2 Plus
Dere\GG14048-PA 199 GG14048-PA 29..173 35..181 167 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10657-PA 224 GH10657-PA 1..224 1..217 869 79.5 Plus
Dgri\GH17008-PA 180 GH17008-PA 61..178 81..200 185 36.9 Plus
Dgri\GH23707-PA 185 GH23707-PA 32..183 35..200 184 32 Plus
Dgri\GH16863-PA 185 GH16863-PA 32..183 35..200 184 32 Plus
Dgri\GH17009-PA 218 GH17009-PA 89..209 82..206 183 37 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13133-PA 217 CG13133-PA 1..217 1..217 1209 100 Plus
Hsp27-PB 213 CG4466-PB 84..210 81..216 192 37.7 Plus
Hsp27-PA 213 CG4466-PA 84..210 81..216 192 37.7 Plus
Hsp23-PB 186 CG4463-PB 66..180 82..198 185 38.7 Plus
Hsp23-PA 186 CG4463-PA 66..180 82..198 185 38.7 Plus
Hsp22-PB 174 CG4460-PB 56..174 79..198 179 36.9 Plus
Hsp22-PA 174 CG4460-PA 56..174 79..198 179 36.9 Plus
Hsp26-PB 208 CG4183-PB 84..182 82..181 164 38.2 Plus
Hsp26-PA 208 CG4183-PA 84..182 82..181 164 38.2 Plus
Hsp67Bc-PA 199 CG4190-PA 29..173 35..181 153 34.8 Plus
Hsp67Ba-PA 445 CG4167-PA 122..241 82..198 147 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10908-PA 218 GI10908-PA 1..218 1..217 950 81.9 Plus
Dmoj\GI13087-PA 209 GI13087-PA 82..200 81..209 185 36.9 Plus
Dmoj\GI12244-PA 183 GI12244-PA 45..158 68..181 173 34.5 Plus
Dmoj\GI13085-PA 185 GI13085-PA 65..163 82..181 168 38.2 Plus
Dmoj\GI12247-PA 211 GI12247-PA 88..186 82..181 154 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19186-PA 217 GL19186-PA 1..192 1..191 932 88.6 Plus
Dper\GL22446-PA 184 GL22446-PA 60..164 75..181 204 40.4 Plus
Dper\GL22443-PA 184 GL22443-PA 60..164 75..181 204 40.4 Plus
Dper\GL22633-PA 196 GL22633-PA 4..173 1..181 174 33.3 Plus
Dper\GL22632-PA 204 GL22632-PA 80..178 82..181 155 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12069-PA 217 GA12069-PA 1..192 1..191 932 88.6 Plus
Dpse\GA18202-PA 184 GA18202-PA 60..164 75..181 201 40.4 Plus
Dpse\GA24923-PA 196 GA24923-PA 4..173 1..181 170 32.8 Plus
Dpse\GA18011-PA 204 GA18011-PA 80..178 82..181 155 33.3 Plus
Dpse\GA16631-PA 177 GA16631-PA 55..173 79..197 152 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12013-PA 217 GM12013-PA 1..217 1..217 1157 98.6 Plus
Dsec\GM25142-PA 183 GM25142-PA 63..177 82..198 188 38.7 Plus
Dsec\GM25140-PA 173 GM25140-PA 56..157 79..181 183 40 Plus
Dsec\GM24881-PA 211 GM24881-PA 84..211 82..217 180 34.1 Plus
Dsec\GM24882-PA 199 GM24882-PA 29..173 35..181 162 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22307-PA 217 GD22307-PA 1..217 1..217 1163 99.5 Plus
Dsim\GD14174-PA 173 GD14174-PA 56..157 79..181 183 40 Plus
Dsim\GD12933-PA 211 GD12933-PA 84..211 82..217 180 34.1 Plus
Dsim\GD14176-PA 177 GD14176-PA 65..171 81..198 165 35.8 Plus
Dsim\GD12934-PA 199 GD12934-PA 29..173 35..181 162 35.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18296-PA 220 GJ18296-PA 1..220 1..217 1007 85.1 Plus
Dvir\GJ13834-PA 186 GJ13834-PA 66..184 82..205 184 36.5 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 84..203 82..209 180 35.4 Plus
Dvir\GJ11479-PA 216 GJ11479-PA 87..213 82..207 168 32.3 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 86..210 82..207 168 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18397-PA 226 GK18397-PA 1..226 1..217 975 81.5 Plus
Dwil\GK17636-PA 186 GK17636-PA 65..163 82..181 195 40.2 Plus
Dwil\GK16566-PA 216 GK16566-PA 88..187 82..181 181 39.2 Plus
Dwil\GK17635-PA 177 GK17635-PA 55..176 79..209 157 33.8 Plus
Dwil\GK19253-PA 192 GK19253-PA 29..172 35..181 157 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26439-PA 217 GE26439-PA 1..217 1..217 1144 97.7 Plus
Dyak\GE20832-PA 186 GE20832-PA 66..180 82..198 194 38.7 Plus
Dyak\GE20830-PA 173 GE20830-PA 56..157 79..181 180 40 Plus
Dyak\GE21250-PA 208 GE21250-PA 84..182 82..181 172 38.2 Plus
Dyak\Hsp67Bc-PA 199 GE21251-PA 29..173 35..181 167 36.1 Plus