Clone IP07649 Report

Search the DGRC for IP07649

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:49
Vector:pOT2
Associated Gene/TranscriptCG13155-RA
Protein status:IP07649.pep: gold
Preliminary Size:711
Sequenced Size:769

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13155 2005-01-01 Successful iPCR screen
CG13155 2008-04-29 Release 5.5 accounting
CG13155 2008-08-15 Release 5.9 accounting
CG13155 2008-12-18 5.12 accounting

Clone Sequence Records

IP07649.complete Sequence

769 bp (769 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022699

> IP07649.complete
TCGATATGGACACACGCTTGCTGACTGCACTATTGCTGATCGCGGCTTGC
AGGGCCGAGGATCCAGATTTGGGTCAGGATCAGGATCAGGCGAAGATCAC
GTTTAAGCCGGGCCGATATGTGCCACGCCTGCACGGTGCCACGGGTTGGT
ATGTTCCGGATGATAGTGGAAAGTACCGGCACGATCCCAGGCCCTATGAC
GGCGGCTATGGAGATCGTGGTGTTCCCTATGACTCCGATTTGAGCGGCAT
TTTCCGGAATGCCCAGCGCCAACTGGAGGCAAAGGTCCAGGAGGCCGGTG
AAGGTCTATCCCTCGGTCCACGAGATCATCTGCGATTCATGATCGACTTT
AATTTCAATGGCACCGGCTGGCAGATAATCCAGTTTCAATGGGTACGAGA
TGGCGATGAGTCCCATCCAGACACCAAGGAGTACAGCTACTTGACGGAGA
ACAAGCTATGGGACTCGGATCAGGCCTATGCGTACCAGGAGCCCGACGAT
GGCTGCCATATCAACTGTCAGCCGGAGACGGCGGTATACCCGCTACAATC
GGAGCCTGTCCAGGAGCCAGTGGTGCAGCCAACTCAGGAGCAGCAACAGT
CCAGAACAAACATCAATTCAGAGCAGGATCCTGGCAAGATTCATGATACC
ATCAATGAAGTCCTGGAGTACATACAACAACGAATCCTGCCTACGTTGCC
AATTAAAGGGGAGTAAATCGGTTTCAGAAACATTCAATAAATAATGAAAA
TAAAAAAAAAAAAAAAAAA

IP07649.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13155-RA 901 CG13155-RA 122..879 1..758 3775 99.8 Plus
CG13155.a 1107 CG13155.a 328..1085 1..758 3775 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8267062..8267690 629..1 3145 100 Minus
chr2R 21145070 chr2R 8266878..8266999 751..630 610 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12379798..12380426 629..1 3145 100 Minus
2R 25286936 2R 12379607..12379735 758..630 630 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12380997..12381625 629..1 3145 100 Minus
2R 25260384 2R 12380806..12380934 758..630 630 99.2 Minus
Blast to na_te.dros performed on 2019-03-16 16:06:05 has no hits.

IP07649.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:06:49 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8266878..8266999 630..751 100 <- Minus
chr2R 8267062..8267690 1..629 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:56 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:37 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:22 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:02 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:19:23 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:57 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:37 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:22 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..751 1..751 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:02 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..711 6..716 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:19:23 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13155-RA 1..751 1..751 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:49 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12379614..12379735 630..751 100 <- Minus
2R 12379798..12380426 1..629 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:49 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12379614..12379735 630..751 100 <- Minus
2R 12379798..12380426 1..629 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:49 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12379614..12379735 630..751 100 <- Minus
2R 12379798..12380426 1..629 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:22 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8267119..8267240 630..751 100 <- Minus
arm_2R 8267303..8267931 1..629 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:36 Download gff for IP07649.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12380997..12381625 1..629 100   Minus
2R 12380813..12380934 630..751 100 <- Minus

IP07649.hyp Sequence

Translation from 2 to 715

> IP07649.hyp
DMDTRLLTALLLIAACRAEDPDLGQDQDQAKITFKPGRYVPRLHGATGWY
VPDDSGKYRHDPRPYDGGYGDRGVPYDSDLSGIFRNAQRQLEAKVQEAGE
GLSLGPRDHLRFMIDFNFNGTGWQIIQFQWVRDGDESHPDTKEYSYLTEN
KLWDSDQAYAYQEPDDGCHINCQPETAVYPLQSEPVQEPVVQPTQEQQQS
RTNINSEQDPGKIHDTINEVLEYIQQRILPTLPIKGE*

IP07649.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13155-PA 236 CG13155-PA 1..236 2..237 1287 100 Plus

IP07649.pep Sequence

Translation from 2 to 715

> IP07649.pep
DMDTRLLTALLLIAACRAEDPDLGQDQDQAKITFKPGRYVPRLHGATGWY
VPDDSGKYRHDPRPYDGGYGDRGVPYDSDLSGIFRNAQRQLEAKVQEAGE
GLSLGPRDHLRFMIDFNFNGTGWQIIQFQWVRDGDESHPDTKEYSYLTEN
KLWDSDQAYAYQEPDDGCHINCQPETAVYPLQSEPVQEPVVQPTQEQQQS
RTNINSEQDPGKIHDTINEVLEYIQQRILPTLPIKGE*

IP07649.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12070-PA 224 GF12070-PA 17..223 24..232 704 67.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22586-PA 234 GG22586-PA 1..234 2..237 1065 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21199-PA 229 GH21199-PA 17..228 16..232 564 53 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13155-PA 236 CG13155-PA 1..236 2..237 1287 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20485-PA 219 GI20485-PA 38..218 44..232 575 57.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10444-PA 232 GL10444-PA 34..231 35..232 681 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12082-PA 232 GA12082-PA 34..231 35..232 668 62.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20366-PA 234 GM20366-PA 1..234 2..237 1195 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25847-PA 234 GD25847-PA 1..234 2..237 1125 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22337-PA 224 GJ22337-PA 1..223 2..232 645 56.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10960-PA 228 GK10960-PA 1..226 2..232 596 53.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13455-PA 235 GE13455-PA 1..233 2..235 1006 83.8 Plus