Clone IP07655 Report

Search the DGRC for IP07655

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:55
Vector:pOT2
Associated Gene/TranscriptCG13460-RB
Protein status:IP07655.pep: gold
Preliminary Size:654
Sequenced Size:674

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13460 2005-01-01 Successful iPCR screen
CG13460 2008-04-29 Release 5.5 accounting
CG13460 2008-08-15 Release 5.9 accounting
CG13460 2008-12-18 5.12 accounting

Clone Sequence Records

IP07655.complete Sequence

674 bp (674 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022691

> IP07655.complete
GAAAATATGCGTCTGTTCGTGGCTCTGGTTTGTGTCAGTTTGGTGGCAGT
GTCATCTGCCCAGTTGTCACTGCGCGGAAGATTGGGACGCTCATCGAAGG
TGGATTTGGCAGTGGAGACACCCACTTTGCTGGCCAAGACAGCCGGACTT
GTGCCCACTGTGCTTGTGAAAAATGCCGGCATAGTGCCCACTGTGTTGGT
AAAGAATGCAGCCCAAATCTTACCTGCCGTCAATGTTGCCGCCGATGTGG
AAACGCCCAGCATCTTGCCCCAAGTGTCCAACAACATCTTGCCCTACTAT
CCCCGCTACTGGCCCGACTATGGATCCTATGGATCCTATGGCTATCCCGG
CGGCTGGAACAGTCCCAGCTACTGGAATAATAACTACTACGACTATGGAG
CACCCTATTTGCCCAGACGTCGTTTTGTTAAGCCCGTTGTGTCCCCTGCC
GTGATCACTGCACCCACTTCCACTGGCTCCTCGTCCACCAGCAGCACTAC
TACCACTGTTTCTGGTGAGGATTCGCCATCTGTGACTACCGATGTCGTTC
CCGATCAGTCGGACGCTTCCGAAAATCAGGTTGCTGAACCCGTGGTCACG
ACCCAGGTGATCTAAGGAGAGGTCTAAAAAATAATAATTAAATTTTATAT
ATTGAAAAAAAAAAAAAAAAAAAA

IP07655.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13460-RB 678 CG13460-RB 24..678 1..655 3275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15051070..15051723 654..1 3195 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15061028..15061682 655..1 3275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15054128..15054782 655..1 3275 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:39:54 has no hits.

IP07655.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:40:37 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15051101..15051723 1..623 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:58 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 1..609 7..615 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:07 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 1..609 7..615 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:01 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 1..609 7..615 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:59 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 1..609 7..615 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:57 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 1..609 7..615 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:46 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 24..677 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:06 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 24..677 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:01 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 24..677 1..654 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:00 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 24..677 1..654 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:57 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13460-RB 24..677 1..654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:37 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15061029..15061682 1..654 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:37 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15061029..15061682 1..654 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:37 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15061029..15061682 1..654 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:01 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15054129..15054782 1..654 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:58 Download gff for IP07655.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15054129..15054782 1..654 100   Minus

IP07655.pep Sequence

Translation from 0 to 614

> IP07655.pep
ENMRLFVALVCVSLVAVSSAQLSLRGRLGRSSKVDLAVETPTLLAKTAGL
VPTVLVKNAGIVPTVLVKNAAQILPAVNVAADVETPSILPQVSNNILPYY
PRYWPDYGSYGSYGYPGGWNSPSYWNNNYYDYGAPYLPRRRFVKPVVSPA
VITAPTSTGSSSTSSTTTTVSGEDSPSVTTDVVPDQSDASENQVAEPVVT
TQVI*

IP07655.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10745-PA 226 GF10745-PA 1..155 3..171 342 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13688-PA 208 GG13688-PA 14..208 1..204 663 77 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG13460-PB 202 CG13460-PB 1..202 3..204 1034 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25855-PA 215 GL25855-PA 1..214 3..204 210 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12303-PA 215 GA12303-PA 1..214 3..204 211 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24508-PA 214 GM24508-PA 14..214 1..204 859 87.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12580-PA 214 GD12580-PA 14..214 1..204 870 89.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19983-PA 209 GE19983-PA 1..209 3..204 687 78.9 Plus

IP07655.hyp Sequence

Translation from 0 to 614

> IP07655.hyp
ENMRLFVALVCVSLVAVSSAQLSLRGRLGRSSKVDLAVETPTLLAKTAGL
VPTVLVKNAGIVPTVLVKNAAQILPAVNVAADVETPSILPQVSNNILPYY
PRYWPDYGSYGSYGYPGGWNSPSYWNNNYYDYGAPYLPRRRFVKPVVSPA
VITAPTSTGSSSTSSTTTTVSGEDSPSVTTDVVPDQSDASENQVAEPVVT
TQVI*

IP07655.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13460-PB 202 CG13460-PB 1..202 3..204 1034 100 Plus