Clone IP07658 Report

Search the DGRC for IP07658

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:58
Vector:pOT2
Associated Gene/TranscriptPtth-RE
Protein status:IP07658.pep: gold
Preliminary Size:639
Sequenced Size:1045

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13687 2005-01-01 Successful iPCR screen
Ptth 2008-04-29 Release 5.5 accounting
Ptth 2008-08-15 Release 5.9 accounting
Ptth 2008-12-18 5.12 accounting

Clone Sequence Records

IP07658.complete Sequence

1045 bp (1045 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022687

> IP07658.complete
CTGGGTCAGTGGGCTTCTTTTGGCTACTCCCACCGCCCAAAGTTCTCCAC
CTCTGCCGGCACTTGAGGCCTTAAAGCCATTTCCCCCATTGAAGCATTGA
AAGCAGCAGAGGAGTATAAATAGCCGAGGGACTCAACCCCATCAGCCGGG
CCACTTGAGCTTGGCATGGCTTGCCATTGTTGTGGTGTCAACTGTGGAGT
CCATTGTTCCATCCTGTCCAGGTGACGAACCGTAATGGATGCTGCTGCTC
TCATCTCTGGCACAAAAGGTAATCCGAGAGGCGGCTTTTGTCCTAAATGG
ATATAAAAGTATGGCGACTCCTTGGCCAGAGCTGCAGAAGGAGTACAGCG
CTGGTCAGGCACAGATCGAGCAGGATGCCGTGGTTGCCCATTTCCATTAT
GGCAATGGCGCTGCTTAGCCTGACAAATAAAGGAATCGCCAGTCAGTACG
CCAGCGATGAAGGTTTGGACGAGATGGTGGGTCTAAGGAGTCTGGAACAC
CGCGCGGAGGAGCAGCAGCCCGATCGCAGTACATCGAAAATGCTCAGTGC
CCTATTCGGATTCAGTCCCAGCACTCCACATCCCACAGAGATGGCGATGG
TCATGCCCCATCAGCTGCCGCCCATGTACTATAACGATTTCTATGAGGAT
CTGGTGACCACCAAACGCAATGATGTCCATTCCGCAGGCTGCGACTGCAA
AGTTACGAATGAGCTCGTGGATCTGGGTGGTCTGCACTTCCCTCGCTTTC
TGATGAATGCCGTTTGCGAATCGGGCGCTGGTCGGGATCTGGCCAAGTGC
TCGCATGGATCCAATTGCAGGCCACTGGAATATAAGGTAAAGGTCCTGGC
ACAGACCTCTCAGTCCGATCACCCCTATTCGTGGATGAACAAGGATCAAC
CTTGGCAGTTCAAAACGGTCACCGTAACTGCCGGCTGCTTCTGCACAAAG
TGATTGAAAGGATGTGAGCAACTATCGTGAATGTGAATTAATTGTATATT
AAAGCGCCAAAAAGACGTCAAAAAAAAAAAAAAAAAAAAAAAAAA

IP07658.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Ptth-RB 1110 Ptth-RB 92..1110 1..1019 5080 99.9 Plus
CG2813-RA 1120 CG2813-RA 1078..1120 1022..980 215 100 Minus
CG2813.a 1048 CG2813.a 1010..1048 1022..984 195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 576518..576900 383..1 1915 100 Minus
chr2L 23010047 chr2L 576085..576409 707..383 1610 99.7 Minus
chr2L 23010047 chr2L 575715..576027 1019..707 1565 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 576514..576896 383..1 1900 99.7 Minus
2L 23513712 2L 576081..576405 707..383 1625 100 Minus
2L 23513712 2L 575708..576023 1022..707 1580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 576514..576896 383..1 1900 99.7 Minus
2L 23513712 2L 576081..576405 707..383 1625 100 Minus
2L 23513712 2L 575708..576023 1022..707 1580 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:43:24 has no hits.

IP07658.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:44:15 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 575715..576026 708..1019 100 <- Minus
chr2L 576085..576408 384..707 99 <- Minus
chr2L 576518..576900 1..383 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:32:58 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RA 1..639 311..953 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:08 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RC 1..711 239..953 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:44:09 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RE 1..579 375..953 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:00 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RA 1..639 311..953 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:44:56 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RF 1..657 297..953 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:47 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RA 1..639 311..953 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:08 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RB 1..1019 1..1019 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:44:09 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RE 1..1019 1..1019 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:00 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RA 1..639 311..953 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:44:56 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
Ptth-RF 1..1019 1..1019 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:15 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575711..576022 708..1019 100 <- Minus
2L 576081..576404 384..707 100 <- Minus
2L 576514..576896 1..383 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:15 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575711..576022 708..1019 100 <- Minus
2L 576081..576404 384..707 100 <- Minus
2L 576514..576896 1..383 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:15 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575711..576022 708..1019 100 <- Minus
2L 576081..576404 384..707 100 <- Minus
2L 576514..576896 1..383 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:44:09 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 576081..576404 384..707 100 <- Minus
arm_2L 575711..576022 708..1019 100 <- Minus
arm_2L 576514..576896 1..383 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:59 Download gff for IP07658.complete
Subject Subject Range Query Range Percent Splice Strand
2L 575711..576022 708..1019 100 <- Minus
2L 576081..576404 384..707 100 <- Minus
2L 576514..576896 1..383 99   Minus

IP07658.pep Sequence

Translation from 296 to 952

> IP07658.pep
MDIKVWRLLGQSCRRSTALVRHRSSRMPWLPISIMAMALLSLTNKGIASQ
YASDEGLDEMVGLRSLEHRAEEQQPDRSTSKMLSALFGFSPSTPHPTEMA
MVMPHQLPPMYYNDFYEDLVTTKRNDVHSAGCDCKVTNELVDLGGLHFPR
FLMNAVCESGAGRDLAKCSHGSNCRPLEYKVKVLAQTSQSDHPYSWMNKD
QPWQFKTVTVTAGCFCTK*

IP07658.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14877-PA 245 GF14877-PA 71..245 44..218 579 61.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24637-PA 219 GG24637-PA 1..219 1..218 1072 90.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11014-PA 219 GH11014-PA 77..219 76..218 458 62.7 Plus
Dgri\GH10502-PA 219 GH10502-PA 77..219 76..218 457 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Ptth-PF 218 CG13687-PF 1..218 1..218 1167 99.5 Plus
Ptth-PE 192 CG13687-PE 1..192 27..218 1039 100 Plus
Ptth-PG 184 CG13687-PG 1..184 35..218 993 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18021-PA 227 GI18021-PA 50..227 52..218 479 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19250-PA 197 GL19250-PA 1..197 27..218 602 65.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12459-PA 197 GA12459-PA 1..197 27..218 603 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16653-PA 192 GM16653-PA 1..192 27..218 1001 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22948-PA 218 GD22948-PA 1..218 1..218 1149 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19677-PA 217 GJ19677-PA 58..217 70..218 441 55.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24630-PA 197 GK24630-PA 16..197 62..218 434 51.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15996-PA 192 GE15996-PA 1..192 27..218 980 92.7 Plus

IP07658.hyp Sequence

Translation from 296 to 952

> IP07658.hyp
MDIKVWRLLGQSCRRSTALVRHRSSMMPWLPISIMAMALLSLTNKGIASQ
YASDEGLDEMVGLRSLEHRAEEQQPDRSTSKMLSALFGFSPSTPHPTEMA
MVMPHQLPPMYYNDFYEDLVTTKRNDVHSAGCDCKVTNELVDLGGLHFPR
FLMNAVCESGAGRDLAKCSHGSNCRPLEYKVKVLAQTSQSDHPYSWMNKD
QPWQFKTVTVTAGCFCTK*

IP07658.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Ptth-PF 218 CG13687-PF 1..218 1..218 1173 100 Plus
Ptth-PE 192 CG13687-PE 1..192 27..218 1039 100 Plus
Ptth-PG 184 CG13687-PG 1..184 35..218 993 100 Plus