Clone IP07660 Report

Search the DGRC for IP07660

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:60
Vector:pOT2
Associated Gene/TranscriptCG13829-RA
Protein status:IP07660.pep: gold
Preliminary Size:636
Sequenced Size:829

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13829 2005-01-01 Successful iPCR screen
CG13829 2008-04-29 Release 5.5 accounting
CG13829 2008-08-15 Release 5.9 accounting
CG13829 2008-12-18 5.12 accounting

Clone Sequence Records

IP07660.complete Sequence

829 bp (829 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022683

> IP07660.complete
TTAAATATAATATAGACAAAATGATTGCCAAGCTGCGCAAGATTTATCCC
AGTGGAAAGGTGGTTAGCCATTCCCTCGCTCCCTGCTCCACAGCGGATCT
GAACAATGCTGAACTTGTTTCCAATGTCAAGAAAAGGCGAGCCGAATATC
TCGTCGAACGAATGCAGCGACTGCTGCTCTTTCTGACCGTCTTCCTTCTG
TTTCCCGTGGTGATCTTCGTCATCTTCAAGTTCTTGATTATGGAGCCGCT
CTACGGAAACAGCGATGACAATGTGGGCATTGGATCCGGCGTAGCCACGG
TAATTGTGATGCATGTCCTGGTCACGGGCTATATCCTGCGCCTGATCTTC
CTTCAAGAGATTTCGAGCATGGAGAAGCTGGAGTGGGAAGTTCTGATGCC
ACCAAACACCCAAATTCATGGATCCGTGTTCATTGTCCTGCTGCTGATGT
CCTACTGTTCCCTAATAATTGGCTTTCCCATAGCCACCTTTTTTGCCCTG
AAATTTGTGGTGCTCAAGAGCTATGCCCATATCAATGCCGATATTATTTC
GACCATTTGCACCGTAGTTGCAGTTCATGCAGCAGTTGGCTTTTACATCT
ACCGAGCCATCTATGCAAAGAGTGTGACGGCCAAAAGCGCCAAAATATCT
CTGTAAAATAATTGTATCTCCACCTTTCGACTATCTTTGATATGCCAATA
CATCACAATACTTTCTTCTGTATATATCTTGAACACTTCCTGCTTTCATC
ATGTGGCTGACATATTTTTCGTGAAAATTGTATTCGTATTCGCCAATGCG
AAAAAATGCTAAAAAAAAAAAAAAAAAAA

IP07660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13829-RA 869 CG13829-RA 59..869 1..811 4055 100 Plus
CG13829.a 1080 CG13829.a 270..1080 1..811 4055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18983919..18984600 810..130 3345 99.7 Minus
chr3R 27901430 chr3R 18984651..18984781 131..1 640 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23160476..23161157 811..130 3410 100 Minus
3R 32079331 3R 23161208..23161338 131..1 655 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22901307..22901988 811..130 3410 100 Minus
3R 31820162 3R 22902039..22902169 131..1 655 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:41:45 has no hits.

IP07660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:42:28 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18983919..18984598 132..810 99 <- Minus
chr3R 18984651..18984781 1..131 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:02 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..636 21..656 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:19 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..636 21..656 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:22 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..636 21..656 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:48 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..636 21..656 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:43 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..636 21..656 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:25 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..810 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:19 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..810 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:22 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..810 1..810 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:48 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..810 1..810 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:43 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
CG13829-RA 1..810 1..810 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:28 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23160477..23161155 132..810 100 <- Minus
3R 23161208..23161338 1..131 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:28 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23160477..23161155 132..810 100 <- Minus
3R 23161208..23161338 1..131 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:28 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23160477..23161155 132..810 100 <- Minus
3R 23161208..23161338 1..131 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:22 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18986930..18987060 1..131 100   Minus
arm_3R 18986199..18986877 132..810 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:19 Download gff for IP07660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22901308..22901986 132..810 100 <- Minus
3R 22902039..22902169 1..131 100   Minus

IP07660.pep Sequence

Translation from 2 to 655

> IP07660.pep
KYNIDKMIAKLRKIYPSGKVVSHSLAPCSTADLNNAELVSNVKKRRAEYL
VERMQRLLLFLTVFLLFPVVIFVIFKFLIMEPLYGNSDDNVGIGSGVATV
IVMHVLVTGYILRLIFLQEISSMEKLEWEVLMPPNTQIHGSVFIVLLLMS
YCSLIIGFPIATFFALKFVVLKSYAHINADIISTICTVVAVHAAVGFYIY
RAIYAKSVTAKSAKISL*

IP07660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18026-PA 212 GF18026-PA 1..209 7..214 628 59.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12454-PA 211 GG12454-PA 1..211 7..217 810 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13829-PA 211 CG13829-PA 1..211 7..217 1046 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23044-PA 203 GL23044-PA 1..199 7..214 444 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12554-PA 203 GA12554-PA 1..199 7..214 448 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23586-PA 211 GM23586-PA 1..211 7..217 950 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18400-PA 211 GD18400-PA 1..211 7..217 955 93.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13232-PA 215 GK13232-PA 25..203 30..204 319 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23977-PA 215 GE23977-PA 1..215 7..217 811 80.9 Plus

IP07660.hyp Sequence

Translation from 2 to 655

> IP07660.hyp
KYNIDKMIAKLRKIYPSGKVVSHSLAPCSTADLNNAELVSNVKKRRAEYL
VERMQRLLLFLTVFLLFPVVIFVIFKFLIMEPLYGNSDDNVGIGSGVATV
IVMHVLVTGYILRLIFLQEISSMEKLEWEVLMPPNTQIHGSVFIVLLLMS
YCSLIIGFPIATFFALKFVVLKSYAHINADIISTICTVVAVHAAVGFYIY
RAIYAKSVTAKSAKISL*

IP07660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13829-PA 211 CG13829-PA 1..211 7..217 1046 100 Plus