Clone IP07664 Report

Search the DGRC for IP07664

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:64
Vector:pOT2
Associated Gene/TranscriptCG13896-RA
Protein status:IP07664.pep: gold
Preliminary Size:633
Sequenced Size:1020

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13896 2005-01-01 Successful iPCR screen
CG13896 2008-04-29 Release 5.5 accounting
CG13896 2008-08-15 Release 5.9 accounting
CG13896 2008-12-18 5.12 accounting

Clone Sequence Records

IP07664.complete Sequence

1020 bp (1020 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024364

> IP07664.complete
AAAGAACTGGCAGCCTGGGAAACAAAACTTATTCGTCATCAACTGAATAG
CTATTGTAAACAATGGATACAAAGTGTGAGTAAAAAACATAAATTCAAGA
AGAAAACTATATATATACTCACAATAAGCCAGCTTACGAAAGGAAGTGGT
GTACATCCAACACCCGACTTTTATTGTCCCTTTACAATGAACGCCAAGCT
GATTTTCGGGATCCGAAAAAAAAGATCAAGGACATTTGGGGGGAAATGGT
CGTTGCCCTTGAAAGCCAGGGAATGACAGATATCGATGCAGTTCAGCTGG
ATCGAAAATTTAGGAACCTGAAGAAGACCTACTATAGCATAAGGAGCAAG
CTCCTGGCGAAGGTACCGCATTTCCATCCAAACTGGCAGTTCTACGACGA
GATGTCCGAAATTCTAAAGGATGACCCTGTCCCACCGCCGCAGGAACTTT
CCATCAATGATTTCGATGAAGCGGTGGTCAGTTTGGAGACCGGTATCCAG
AAAGGCAGGATGCTGTCTATGGGCACCACTGTCAGCACAGTTATTCCCCG
CCAAATGCGTACGTATCGCAAACGAAAGCAGCCATTGGATGATGTCGATA
TCAAGATCCAGAAGGACTACGAAGTGCAAACGGATCGGCAGCGGGATGGG
GAACAGTTTACAGTCTTTAATGCCGCCGAACCCAATACTAATGATTTGTC
AGAGTCTGCGGCCGAGATCTCCATCAGCAACGACGAAGAGGCATTGAGAC
ACCTAAGAGCGCTCCAGGAGTACGCCATGATCCATGATAATTTCAGGGCC
ATAGGACTGCTAATACAGGTGGAGCACGCCATTCAATATCCAGCCCAGAT
CAAGGACTTCGAGGTGGATCAAACGTAGTGTCCTTATAAACAAGCACGTA
ATCTACTGGAAAAGCAAAGATAAGATAAGGCACATACCTAATTTATACCT
CTATATTTAAGATTTTAATATTTTATAATATATATACTTTAATTTACTTT
AAAAAAAAAAAAAAAAAAAA

IP07664.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13896-RA 1001 CG13896-RA 1..1001 1..1001 5005 100 Plus
CG13896.a 1100 CG13896.a 232..1100 133..1001 4345 100 Plus
CG13896-RB 1098 CG13896-RB 230..1098 133..1001 4345 100 Plus
CG13896.a 1100 CG13896.a 157..231 1..75 375 100 Plus
CG13896-RB 1098 CG13896-RB 157..229 1..73 365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 710638..711626 1000..1 4800 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 710819..711819 1001..1 5005 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 710819..711819 1001..1 5005 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:24:57 has no hits.

IP07664.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:25:58 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 710688..711626 1..939 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:08 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RB 1..633 246..878 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:42 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RB 1..633 246..878 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:34 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..633 246..878 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:57 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RB 1..633 246..878 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:52 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..633 246..878 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:08 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:42 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:34 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:57 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:52 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
CG13896-RA 1..1000 1..1000 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:58 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
3L 710820..711819 1..1000 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:58 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
3L 710820..711819 1..1000 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:58 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
3L 710820..711819 1..1000 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:34 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 710820..711819 1..1000 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:05 Download gff for IP07664.complete
Subject Subject Range Query Range Percent Splice Strand
3L 710820..711819 1..1000 100   Minus

IP07664.pep Sequence

Translation from 245 to 877

> IP07664.pep
MVVALESQGMTDIDAVQLDRKFRNLKKTYYSIRSKLLAKVPHFHPNWQFY
DEMSEILKDDPVPPPQELSINDFDEAVVSLETGIQKGRMLSMGTTVSTVI
PRQMRTYRKRKQPLDDVDIKIQKDYEVQTDRQRDGEQFTVFNAAEPNTND
LSESAAEISISNDEEALRHLRALQEYAMIHDNFRAIGLLIQVEHAIQYPA
QIKDFEVDQT*

IP07664.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24069-PA 221 GF24069-PA 48..220 5..206 250 36.1 Plus
Dana\GF20064-PA 53 GF20064-PA 3..53 157..207 160 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14640-PA 211 GG14640-PA 1..211 1..210 859 77.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16033-PA 74 GH16033-PA 25..74 158..207 159 58 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13896-PB 210 CG13896-PB 1..210 1..210 1075 100 Plus
CG13896-PC 210 CG13896-PC 1..210 1..210 1075 100 Plus
CG13896-PA 210 CG13896-PA 1..210 1..210 1075 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14255-PA 209 GM14255-PA 1..209 1..210 974 87.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13511-PA 209 GD13511-PA 1..209 1..210 978 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13233-PA 368 GJ13233-PA 319..368 158..207 153 56 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20998-PA 210 GE20998-PA 1..210 1..210 871 78.1 Plus

IP07664.hyp Sequence

Translation from 245 to 877

> IP07664.hyp
MVVALESQGMTDIDAVQLDRKFRNLKKTYYSIRSKLLAKVPHFHPNWQFY
DEMSEILKDDPVPPPQELSINDFDEAVVSLETGIQKGRMLSMGTTVSTVI
PRQMRTYRKRKQPLDDVDIKIQKDYEVQTDRQRDGEQFTVFNAAEPNTND
LSESAAEISISNDEEALRHLRALQEYAMIHDNFRAIGLLIQVEHAIQYPA
QIKDFEVDQT*

IP07664.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13896-PB 210 CG13896-PB 1..210 1..210 1075 100 Plus
CG13896-PC 210 CG13896-PC 1..210 1..210 1075 100 Plus
CG13896-PA 210 CG13896-PA 1..210 1..210 1075 100 Plus