Clone IP07673 Report

Search the DGRC for IP07673

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:73
Vector:pOT2
Associated Gene/Transcriptver-RA
Protein status:IP07673.pep: gold
Preliminary Size:645
Sequenced Size:864

Clone Sequence Records

IP07673.complete Sequence

864 bp assembled on 2009-04-22

GenBank Submission: BT082062.1

> IP07673.complete
AGTTTGCCCACTTGCTGTGCGCAATGATGGTGCTGCCAACCTGGCGTTTT
GTGCAAATGAATTTCTCTCGGTGGTGAAATAATGACTAAGCAAATAGAAT
GGATTTTAATCAGAGTTTCGAGGACATAGAAAGCCAGCTGGATAACTTCG
TGATACGCAAGAATCAACAGAGTGAAAAGTCCACGGGCAAATGTGGTCCG
GAGGTCCACGACAACGTGCCGCTGACCATATCCCAGATTGAGCGCGCAAC
TCAGGATCCGGAGAACGAGAATGTGTTCATCACAGACGACGTGCATCCGA
TTCACTTCTGCACCTGCATCATCTACGCCTTTGTAACTGGCAATGGAACG
CACAACGAGTCGTTCATGAAGTTCATGATCGATGATGGCACCGGCTCCCT
GGAGGCCAGCATCACCAAAAAACCCTTCAATGGACGCGTGATCAGCAGCC
TGTACAGTGAAGCCAGTTCGCTGGCCTCGTCCGAGGCCTACAAGAGCATT
GCCGTGAGCATGATGCGGCTGCTGCAGGTCTCCATGGAGTACATTGATCC
CACGCGCATCTCGAGGGGCCACAGCCTATTCCTGCGCGGTCGTCCGAATA
GGTTCCGCGGCAAGATGGGTCTGGACGCTTTTCAGTTCTTCATAGACAGC
GGCCGATCGCGGAATATGGAAATTGGCTTCGTAGACTACCTAACCGACTG
GCAACGAAGGCATAAAACAATGCAGAATACAACAAATAAATAGTATCGTT
GGTTTTTTGTATTGAAATTTTACTGGTAATAAAAATTCAAAAAGTTTTAA
ATAAGGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

IP07673.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)S147910.a 810 l(3)S147910.a 1..810 1..810 4050 100 Plus
eIF-2beta-RA 1388 eIF-2beta-RA 1198..1388 810..620 955 100 Minus
eIF-2beta.c 1725 eIF-2beta.c 1535..1725 810..620 955 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12515030..12515754 84..808 3580 99.6 Plus
chr3L 24539361 chr3L 12514590..12514673 1..84 405 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12524426..12525152 84..810 3635 100 Plus
3L 28110227 3L 12523987..12524070 1..84 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12517526..12518252 84..810 3635 100 Plus
3L 28103327 3L 12517087..12517170 1..84 420 100 Plus
Blast to na_te.dros performed 2019-03-15 17:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3839..3878 767..806 110 75 Plus

IP07673.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:13:29 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12514590..12514673 1..84 98 -> Plus
chr3L 12515031..12515754 85..808 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:52 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)S147910-RA 1..645 99..743 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:49 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RA 1..645 99..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:16:43 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RB 1..645 99..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:12 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RB 1..645 99..743 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-22 13:44:48 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)S147910-RA 1..645 99..743 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:49 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RA 1..808 1..808 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:16:43 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RA 1..808 1..808 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:12 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
ver-RA 1..808 1..808 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:29 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12523987..12524070 1..84 100 -> Plus
3L 12524427..12525150 85..808 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:29 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12523987..12524070 1..84 100 -> Plus
3L 12524427..12525150 85..808 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:29 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12523987..12524070 1..84 100 -> Plus
3L 12524427..12525150 85..808 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:16:43 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12517087..12517170 1..84 100 -> Plus
arm_3L 12517527..12518250 85..808 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:31:34 Download gff for IP07673.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12517527..12518250 85..808 100   Plus
3L 12517087..12517170 1..84 100 -> Plus

IP07673.pep Sequence

Translation from 98 to 742

> IP07673.pep
MDFNQSFEDIESQLDNFVIRKNQQSEKSTGKCGPEVHDNVPLTISQIERA
TQDPENENVFITDDVHPIHFCTCIIYAFVTGNGTHNESFMKFMIDDGTGS
LEASITKKPFNGRVISSLYSEASSLASSEAYKSIAVSMMRLLQVSMEYID
PTRISRGHSLFLRGRPNRFRGKMGLDAFQFFIDSGRSRNMEIGFVDYLTD
WQRRHKTMQNTTNK*

IP07673.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10432-PA 210 GF10432-PA 1..205 1..204 521 47.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15580-PA 214 GG15580-PA 1..214 1..214 988 83.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14712-PA 216 GH14712-PA 7..215 8..207 383 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
ver-PA 214 CG14121-PA 1..214 1..214 1118 100 Plus
ver-PB 214 CG14121-PB 1..214 1..214 1118 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12259-PA 215 GI12259-PA 2..213 3..205 409 38.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25197-PA 210 GL25197-PA 1..209 1..206 529 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12773-PA 210 GA12773-PA 1..209 1..206 526 46.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25351-PA 221 GM25351-PA 1..212 1..212 1112 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14384-PA 214 GD14384-PA 1..214 1..214 1119 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11490-PA 215 GJ11490-PA 7..212 8..205 438 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12525-PA 218 GK12525-PA 12..218 9..210 433 44.8 Plus
Dwil\GK14293-PA 202 GK14293-PA 3..201 2..204 413 42.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21909-PA 214 GE21909-PA 1..214 1..214 995 83.2 Plus

IP07673.hyp Sequence

Translation from 98 to 742

> IP07673.hyp
MDFNQSFEDIESQLDNFVIRKNQQSEKSTGKCGPEVHDNVPLTISQIERA
TQDPENENVFITDDVHPIHFCTCIIYAFVTGNGTHNESFMKFMIDDGTGS
LEASITKKPFNGRVISSLYSEASSLASSEAYKSIAVSMMRLLQVSMEYID
PTRISRGHSLFLRGRPNRFRGKMGLDAFQFFIDSGRSRNMEIGFVDYLTD
WQRRHKTMQNTTNK*

IP07673.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
ver-PA 214 CG14121-PA 1..214 1..214 1118 100 Plus
ver-PB 214 CG14121-PB 1..214 1..214 1118 100 Plus