Clone IP07694 Report

Search the DGRC for IP07694

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:76
Well:94
Vector:pOT2
Associated Gene/TranscriptCG14757-RA
Protein status:IP07694.pep: gold
Preliminary Size:639
Sequenced Size:740

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14757 2005-01-01 Successful iPCR screen
CG14757 2008-04-29 Release 5.5 accounting
CG14757 2008-08-15 Release 5.9 accounting
CG14757 2008-12-18 5.12 accounting

Clone Sequence Records

IP07694.complete Sequence

740 bp (740 high quality bases) assembled on 2005-03-01

GenBank Submission: BT022667

> IP07694.complete
ATATTTTGATTTTTCAAATTTTCCGATAGCTCAATACAAATCCAAAAATA
CCCACCGAACAGAAAAATTTTTAAGAATTCCATAATTGTCTGTACCCAGA
ATGCTGCGCCAACTACGGTTGACAATGGATATTTCGGGTTGGATCTTCCT
CCCGTGGAGACGCTCCATGTCCAACATGAAGGACTCTCCTCCACCGCCAC
CACCACTGGCCAGCACTTTCAACGACGTGATTGTGGACTACGAGGACCCG
GATTATCTTCCACTGCCGGAGTATCCGGTGCGTCCAAACGAGCCGTTGGA
AACTCGCAAGCAACGGCTTTTGTACCAATCGCGCAAGCGCGGAATGCTGG
AGAACGATCTTCTGCTGAGCACCTTTGCGGCCAAGCATCTCCAGAACTTC
AGCGCCGAGCAGACGGCGCAGTACGACCAGTTGATCAACGGGGTCAGCAA
CGACTGGGATATCTATTACTGGGCCACCGAGGTGAAGCCCACGCCCAAGG
AGTACGACACGGAGATCATGGGGCTGTTGAAGGAGCACGTCAAGAACGCC
GAACGGGTCACGCGACTCCGCCAGCCGGATCTGAATATTTAGGCATGCAC
CTGGTGCTTATGAATATGATTAGTTAGAAGTTTATATGATCCAGGAGATC
ATATCCTTACCACAATAACCAAAGCGCAAATATGTATGTTTAGAATACCA
AATATAATCAATATTTAAAGTTCAAAAAAAAAAAAAAAAA

IP07694.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14757-RA 746 CG14757-RA 74..746 1..673 3365 100 Plus
CG12895.a 672 CG12895.a 165..415 230..480 565 81.6 Plus
CG12895-RA 751 CG12895-RA 220..470 230..480 565 81.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4059898..4060306 723..315 2045 100 Minus
chr2R 21145070 chr2R 4060706..4060904 316..118 995 100 Minus
chr2R 21145070 chr2R 4061014..4061131 118..1 590 100 Minus
chr2R 21145070 chr2R 6324289..6324494 543..338 430 80.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:52:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8172364..8172772 723..315 2045 100 Minus
2R 25286936 2R 8173172..8173370 316..118 995 100 Minus
2R 25286936 2R 8173480..8173597 118..1 590 100 Minus
2R 25286936 2R 10436855..10436997 480..338 415 86 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8173563..8173971 723..315 2045 100 Minus
2R 25260384 2R 8174371..8174569 316..118 995 100 Minus
2R 25260384 2R 8174679..8174796 118..1 590 100 Minus
2R 25260384 2R 10438054..10438196 480..338 415 86 Minus
2R 25260384 2R 10438280..10438366 316..230 165 79.3 Minus
Blast to na_te.dros performed 2019-03-15 17:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 4560..4635 76..1 127 66.2 Minus
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2226..2298 197..125 112 64.9 Minus

IP07694.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4059898..4060305 316..723 100 <- Minus
chr2R 4060707..4060903 119..315 100 <- Minus
chr2R 4061014..4061131 1..118 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:11 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 1..492 101..592 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:59 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 1..492 101..592 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:45:42 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 1..492 101..592 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:07 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 1..492 101..592 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 1..492 101..592 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:28:41 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 17..639 1..623 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:59 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 17..639 1..623 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:45:42 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 17..739 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:07 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 17..639 1..623 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
CG14757-RA 17..739 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8172364..8172771 316..723 100 <- Minus
2R 8173173..8173369 119..315 100 <- Minus
2R 8173480..8173597 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8172364..8172771 316..723 100 <- Minus
2R 8173173..8173369 119..315 100 <- Minus
2R 8173480..8173597 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:23 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8172364..8172771 316..723 100 <- Minus
2R 8173173..8173369 119..315 100 <- Minus
2R 8173480..8173597 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:45:42 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4060985..4061102 1..118 100   Minus
arm_2R 4059869..4060276 316..723 100 <- Minus
arm_2R 4060678..4060874 119..315 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:31 Download gff for IP07694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8173563..8173970 316..723 100 <- Minus
2R 8174372..8174568 119..315 100 <- Minus
2R 8174679..8174796 1..118 100   Minus

IP07694.hyp Sequence

Translation from 100 to 591

> IP07694.hyp
MLRQLRLTMDISGWIFLPWRRSMSNMKDSPPPPPPLASTFNDVIVDYEDP
DYLPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNF
SAEQTAQYDQLINGVSNDWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNA
ERVTRLRQPDLNI*

IP07694.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14757-PA 163 CG14757-PA 1..163 1..163 872 100 Plus
CG12895-PB 156 CG12895-PB 39..156 44..161 536 82.2 Plus
CG12895-PA 156 CG12895-PA 39..156 44..161 536 82.2 Plus

IP07694.pep Sequence

Translation from 100 to 591

> IP07694.pep
MLRQLRLTMDISGWIFLPWRRSMSNMKDSPPPPPPLASTFNDVIVDYEDP
DYLPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAKHLQNF
SAEQTAQYDQLINGVSNDWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNA
ERVTRLRQPDLNI*

IP07694.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11203-PA 163 GF11203-PA 1..158 1..161 737 86.3 Plus
Dana\GF11110-PA 156 GF11110-PA 1..156 1..161 525 64.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10665-PA 162 GG10665-PA 1..161 1..162 809 95.1 Plus
Dere\GG25208-PA 156 GG25208-PA 39..156 44..161 526 81.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20634-PA 206 GH20634-PA 51..206 2..161 526 65.6 Plus
Dgri\GH20828-PA 147 GH20828-PA 26..144 43..162 469 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14757-PA 163 CG14757-PA 1..163 1..163 872 100 Plus
CG12895-PB 156 CG12895-PB 39..156 44..161 536 82.2 Plus
CG12895-PA 156 CG12895-PA 39..156 44..161 536 82.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20928-PA 157 GI20928-PA 28..152 37..162 527 81.7 Plus
Dmoj\GI20197-PA 157 GI20197-PA 1..157 1..161 519 64 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10881-PA 160 GL10881-PA 1..160 1..162 681 82.1 Plus
Dper\GL17204-PA 157 GL17204-PA 40..157 44..161 528 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24523-PA 160 GA24523-PA 1..160 1..162 681 82.1 Plus
Dpse\GA25039-PA 157 GA25039-PA 40..157 44..161 531 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20711-PA 163 GM20711-PA 1..162 1..162 848 99.4 Plus
Dsec\GM20523-PA 156 GM20523-PA 39..156 44..161 528 82.2 Plus
Dsec\GM19620-PA 80 GM19620-PA 1..72 1..72 369 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10178-PA 163 GD10178-PA 1..162 1..162 848 99.4 Plus
Dsim\GD25982-PA 156 GD25982-PA 39..156 44..161 523 81.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20655-PA 319 GJ20655-PA 180..313 17..161 535 71.7 Plus
Dvir\GJ20144-PA 158 GJ20144-PA 41..158 44..161 505 78.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15773-PA 157 GK15773-PA 1..156 1..161 609 74.5 Plus
Dwil\GK18008-PA 156 GK18008-PA 39..156 44..161 517 78.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23226-PA 162 GE23226-PA 1..161 1..162 792 94.4 Plus
Dyak\GE21507-PA 156 GE21507-PA 39..156 44..161 525 82.2 Plus