Clone IP07706 Report

Search the DGRC for IP07706

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:6
Vector:pOT2
Associated Gene/TranscriptPrpk-RA
Protein status:IP07706.pep: gold
Preliminary Size:675
Sequenced Size:764

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10673 2005-01-01 Successful iPCR screen
CG10673 2008-04-29 Release 5.5 accounting
CG10673 2008-08-15 Release 5.9 accounting
CG10673 2008-12-18 5.12 accounting

Clone Sequence Records

IP07706.complete Sequence

764 bp (764 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022659

> IP07706.complete
TTTAAGACAAGTGCACCGGTTTGTTTTCAAGCGTATTAAAAATGTCCCTA
GAAATCCTGAAACAAGGCGCTGAAGGACGCCTATATTTGGGCGATTTCAA
AGGAGAAGCCTGCCTGATCAAGGAGCGGTTCGTAAAGAAGTACCGCCACC
CGGAACTGAACACCCAGATCACGCGGCAGCGCATGAAAGCGGAGGCCAAG
GCATCGGGAAGATGTCTAGCCGCTGGAATCCTGGCACCAAAGATCCTCCA
CTCGGACCTCAACACCCACAAGCTGTATATGGAATATTTCGATGCAGCCA
AGACTGCCAAGCAGTTCATCCAGGAAACAGTGTCCACTCAGACGGAGGAT
GAAGCCAAGAAATGTCTGCTGGAGTTCTGCACGCGGATCGGTGAAATCAT
TGGGAAAATGCACTCCAATCACATTATACATGGCGATCTCACCACATCTA
ACATCCTCATCAATCCGAAGGGTGGCGACTACGATGTCATTCTGATTGAC
TTCGGCTTGAGCCACTACAATCAGGCCACCGAGGACAAGGGTGTGGATCT
GTACGTCCTGGAGCGGGCGCTACTCAGTACGCACAGCGAACAGCCGTATA
TCTTCGAGCACGTCCTGGCCGCCTATCGCACAGCGTGCGGTAAGGACGAA
CAGGCAGTGCTCACCAAGTTCGAGGAGGTGCGAGCACGCGGACGCAAAAG
AACCATGATTGGTTAACGAATAATAATAAACTTTATTGGGAGTTAAAAAA
AAAAAAAAAAAAAA

IP07706.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG10673-RA 744 CG10673-RA 1..744 1..744 3720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5131208..5131951 744..1 3495 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5138649..5139395 747..1 3735 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5131749..5132495 747..1 3735 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:39:58 has no hits.

IP07706.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:40:47 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5131208..5131951 1..744 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:14 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:22 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:56 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
Prpk-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:50 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:44:59 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
Prpk-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:30 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:22 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..744 1..744 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:56 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
Prpk-RA 1..744 1..744 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:50 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
CG10673-RA 1..675 42..716 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:44:59 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
Prpk-RA 1..744 1..744 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:47 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5138652..5139395 1..744 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:47 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5138652..5139395 1..744 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:47 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5138652..5139395 1..744 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:56 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5131752..5132495 1..744 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:21 Download gff for IP07706.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5131752..5132495 1..744 100   Minus

IP07706.hyp Sequence

Translation from 41 to 715

> IP07706.hyp
MSLEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKA
EAKASGRCLAAGILAPKILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQ
TEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGDLTTSNILINPKGGDYDVI
LIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRTACG
KDEQAVLTKFEEVRARGRKRTMIG*

IP07706.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Prpk-PA 224 CG10673-PA 1..224 1..224 1158 100 Plus

IP07706.pep Sequence

Translation from 41 to 715

> IP07706.pep
MSLEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKA
EAKASGRCLAAGILAPKILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQ
TEDEAKKCLLEFCTRIGEIIGKMHSNHIIHGDLTTSNILINPKGGDYDVI
LIDFGLSHYNQATEDKGVDLYVLERALLSTHSEQPYIFEHVLAAYRTACG
KDEQAVLTKFEEVRARGRKRTMIG*

IP07706.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10474-PA 224 GF10474-PA 1..224 1..224 1049 86.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14144-PA 221 GG14144-PA 1..221 1..224 1013 84.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15277-PA 227 GH15277-PA 1..227 1..224 988 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Prpk-PA 224 CG10673-PA 1..224 1..224 1158 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11986-PA 224 GI11986-PA 1..224 1..224 1011 83 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22471-PA 224 GL22471-PA 1..224 1..224 879 71 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10484-PA 224 GA10484-PA 1..224 1..224 879 71 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13931-PA 224 GM13931-PA 1..224 1..224 1157 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13212-PA 224 GD13212-PA 1..224 1..224 1175 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12210-PA 227 GJ12210-PA 1..227 1..224 988 81.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20053-PA 223 GK20053-PA 1..223 1..224 966 79.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20573-PA 224 GE20573-PA 1..224 1..224 1095 91.5 Plus