Clone IP07710 Report

Search the DGRC for IP07710

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:10
Vector:pOT2
Associated Gene/TranscriptCG11043-RA
Protein status:IP07710.pep: gold
Preliminary Size:655
Sequenced Size:614

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11043 2005-01-01 Successful iPCR screen
CG11043 2008-04-29 Release 5.5 accounting
CG11043 2008-08-15 Release 5.9 accounting
CG11043 2008-12-18 5.12 accounting

Clone Sequence Records

IP07710.complete Sequence

614 bp (614 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022655

> IP07710.complete
AATTCTCGTGTGATAACCATAATTTTCTAGATAAACTCCTTTAAAAATGT
CGTCCTACATTTCGCGTCTACTTAAGGCTCAGTCCGCCTCCAAACGTCTG
ATCTCCAATTTAACCCAGCGCGACGGAAAGCTAAGCTCTTTGCTTCGACG
ACTAGGTTTACAGTGGCAAGGATCAGCCGCTGCTCCTCAACAGCGTCCCA
TATCCACAACTCAGGTGCAAAAGTCAGCGCTAATTGCGGACGATCAACTG
GTCACCGGGATTCAGAAGCGCGAAATGCTGCTGGCCAAGCAGGGCTGCGA
GGACCCTTGGGGTTTCAGCAAGGTGATCAGGCGCGGATCGGGAAGGGAGA
ACGACCCCACCGTCGTGCCATCGGCGTTCGATGCACGCCTCGTAGGCTGT
CTGTGCCTGGATGACCGCTTGCCCAAGTGGATGTGGATTGAGAAGGACGA
GGGACCGAAGCGGTGCGAGTGCGGCCACTACTTCATCCTCAAGAATGTCC
CACCCGTTTAGATCGATCACACAGAGCGCTGTACTTAACACGAACACACT
TGGCATGATCCTCAGCTGGCATTAAACATTGCATGATATTATCAAAAAAA
AAAAAAAAAAAAAA

IP07710.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11043-RA 662 CG11043-RA 70..662 1..593 2965 100 Plus
CG9596-RB 1557 CG9596-RB 1504..1557 601..548 255 98.1 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6558745..6559112 226..593 1840 100 Plus
chr2L 23010047 chr2L 6558464..6558690 1..227 1135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6559766..6560141 226..601 1865 99.7 Plus
2L 23513712 2L 6559485..6559711 1..227 1135 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6559766..6560141 226..601 1865 99.7 Plus
2L 23513712 2L 6559485..6559711 1..227 1135 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:56:40 has no hits.

IP07710.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:57:22 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6558464..6558690 1..227 100 -> Plus
chr2L 6558747..6559112 228..593 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:15 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 1..465 47..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:57 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 1..465 47..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:28 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 1..465 47..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:24 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 1..465 47..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:54 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 1..465 47..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:17 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 55..647 1..593 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:56 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 55..647 1..593 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:28 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 55..647 1..593 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:24 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 55..647 1..593 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:54 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11043-RA 55..647 1..593 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:22 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6559485..6559711 1..227 100 -> Plus
2L 6559768..6560133 228..593 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:22 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6559485..6559711 1..227 100 -> Plus
2L 6559768..6560133 228..593 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:22 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6559485..6559711 1..227 100 -> Plus
2L 6559768..6560133 228..593 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:28 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6559485..6559711 1..227 100 -> Plus
arm_2L 6559768..6560133 228..593 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:43 Download gff for IP07710.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6559485..6559711 1..227 100 -> Plus
2L 6559768..6560133 228..593 100   Plus

IP07710.pep Sequence

Translation from 46 to 510

> IP07710.pep
MSSYISRLLKAQSASKRLISNLTQRDGKLSSLLRRLGLQWQGSAAAPQQR
PISTTQVQKSALIADDQLVTGIQKREMLLAKQGCEDPWGFSKVIRRGSGR
ENDPTVVPSAFDARLVGCLCLDDRLPKWMWIEKDEGPKRCECGHYFILKN
VPPV*

IP07710.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14171-PA 155 GF14171-PA 1..155 1..154 659 82.6 Plus
Dana\GF14170-PA 120 GF14170-PA 1..114 29..148 220 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10420-PA 155 GG10420-PA 1..155 1..154 684 86.8 Plus
Dere\GG10419-PA 120 GG10419-PA 1..114 29..148 228 41.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13842-PA 157 GH13842-PA 1..157 1..154 445 56.8 Plus
Dgri\GH13841-PA 120 GH13841-PA 1..114 29..148 220 40.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
COX5BL-PA 154 CG11043-PA 1..154 1..154 807 100 Plus
COX5B-PB 120 CG11015-PB 1..114 29..148 223 41.8 Plus
COX5B-PA 120 CG11015-PA 1..114 29..148 223 41.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20357-PA 160 GI20357-PA 1..160 1..154 463 59.6 Plus
Dmoj\GI20346-PA 120 GI20346-PA 1..114 29..148 228 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25677-PA 151 GL25677-PA 1..151 1..154 533 67.1 Plus
Dper\GL25676-PA 120 GL25676-PA 1..114 29..148 222 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28178-PA 151 GA28178-PA 1..151 1..154 533 67.1 Plus
Dpse\GA10724-PA 151 GA10724-PA 1..151 1..154 533 67.1 Plus
Dpse\GA28177-PA 120 GA28177-PA 1..114 29..148 222 41 Plus
Dpse\GA10709-PA 120 GA10709-PA 1..114 29..148 222 41 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16174-PA 155 GM16174-PA 1..155 1..154 791 98.1 Plus
Dsec\GM16172-PA 120 GM16172-PA 1..114 29..148 227 41.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVb-PA 155 GD23419-PA 1..155 1..154 791 98.1 Plus
Dsim\GD23418-PA 120 GD23418-PA 1..114 29..148 227 41.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13709-PA 158 GJ13709-PA 1..158 1..154 486 60.4 Plus
Dvir\GJ13698-PA 120 GJ13698-PA 1..114 29..148 227 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15324-PA 151 GK15324-PA 1..151 1..154 531 66.9 Plus
Dwil\GK15323-PA 120 GK15323-PA 1..114 29..148 229 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13977-PA 155 GE13977-PA 1..155 1..154 687 93.5 Plus
Dyak\GE13966-PA 120 GE13966-PA 12..114 46..148 223 42.9 Plus

IP07710.hyp Sequence

Translation from 46 to 510

> IP07710.hyp
MSSYISRLLKAQSASKRLISNLTQRDGKLSSLLRRLGLQWQGSAAAPQQR
PISTTQVQKSALIADDQLVTGIQKREMLLAKQGCEDPWGFSKVIRRGSGR
ENDPTVVPSAFDARLVGCLCLDDRLPKWMWIEKDEGPKRCECGHYFILKN
VPPV*

IP07710.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11043-PA 154 CG11043-PA 1..154 1..154 807 100 Plus
CoVb-PB 120 CG11015-PB 1..114 29..148 223 41.8 Plus
CoVb-PA 120 CG11015-PA 1..114 29..148 223 41.8 Plus