Clone IP07718 Report

Search the DGRC for IP07718

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:18
Vector:pOT2
Associated Gene/TranscriptCG11697-RA
Protein status:IP07718.pep: gold
Preliminary Size:723
Sequenced Size:953

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11697 2005-01-01 Successful iPCR screen
CG11697 2008-04-29 Release 5.5 accounting
CG11697 2008-08-15 Release 5.9 accounting
CG11697 2008-12-18 5.12 accounting

Clone Sequence Records

IP07718.complete Sequence

953 bp (953 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022651

> IP07718.complete
TCAAACCAAATGAACAAAATCGAGAACCGAATACACAGCTATATATATAC
TTTCTCAAAATCCAAAATTTTAAGATTATCCAAAATTTCCAAATAATGAT
TTATGCGATCGTGATACACATACTGTCCCTTCTGGTGGGCTGTTTCTATC
CAGCATTCGCGTCCTACAAGATCCTGAAAAGTCAGAATTGTAGCGTCAAT
GATCTTCGCGGATGGTTAATCTACTGGATTGCCTATGGAGTTTATGTGGC
CTTTGATTATTTCACAGCGGGTCTGCTGGCATTTATTCCATTGCTAAGTG
AGTTCAAGGTGCTTCTCCTGTTCTGGATGTTGCCCTCTGTGGGCGGCGGC
AGTGAGGTGATCTACGAGGAGTTCCTGCGATCCTTTAGCTGTAACGAATC
CTTCGACCAGGTCCTGGGACGTATCACCTTGGAATGGGGCGAATTGGTGT
GGCAACAAGTTTGCTCCGTTCTTAGCCATTTGATGGTTTTGGCAGATCGC
TATCTCCTGCCCAGCGGTCATCGTCCTGCCCTCCAAATAACGCCCAGCAT
CGAGGATCTGGTCAACGATGCCATAGCCAAAAGGCAGTTGGAAGAGAAGC
GGAAACAGATGGGTAACTTATCTGATACCATCAACGAGGTTTTGGGAGAA
AATATCGATTTAAATATGGATCTGCTGCACGGATCCGAATCTGATTTATT
GGTTATTAAGGAGCCTATTTCCAAGCCCAAGGAGAGACCAATACCGCCGC
CGAAGCCAATGCGTCAGCCATCATCAAGCAACCAGCAAGAAATGAATCTT
TCGTCGCAGTTTATGTGACATCAATTGATATCCTCAATATGTCAGGCGGA
AGTTGTCAAAGTTCAGAGCTTTCAAAAAGCATACATCTCAGAAATAAACT
AACCTTACCGCAATAAAGTTTATACAAAAAAAGCAAAAAAAAAAAAAAAA
AAA

IP07718.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG11697-RA 934 CG11697-RA 1..934 1..934 4670 100 Plus
CG11697.a 880 CG11697.a 355..880 409..934 2630 100 Plus
CG11697.a 880 CG11697.a 1..358 1..358 1790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11463906..11464839 1..934 4670 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11572707..11573641 1..935 4675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11580805..11581739 1..935 4675 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:40:38 has no hits.

IP07718.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:29 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11463906..11464839 1..934 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:16 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:23 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:36:31 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:51 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:50 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:33 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:23 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:36:31 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:51 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..723 96..818 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:50 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
CG11697-RA 1..934 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:29 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
X 11572707..11573640 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:29 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
X 11572707..11573640 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:29 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
X 11572707..11573640 1..934 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:36:31 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11466740..11467673 1..934 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:22 Download gff for IP07718.complete
Subject Subject Range Query Range Percent Splice Strand
X 11580805..11581738 1..934 100   Plus

IP07718.pep Sequence

Translation from 2 to 817

> IP07718.pep
KPNEQNREPNTQLYIYFLKIQNFKIIQNFQIMIYAIVIHILSLLVGCFYP
AFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSE
FKVLLLFWMLPSVGGGSEVIYEEFLRSFSCNESFDQVLGRITLEWGELVW
QQVCSVLSHLMVLADRYLLPSGHRPALQITPSIEDLVNDAIAKRQLEEKR
KQMGNLSDTINEVLGENIDLNMDLLHGSESDLLVIKEPISKPKERPIPPP
KPMRQPSSSNQQEMNLSSQFM*

IP07718.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20320-PA 267 GF20320-PA 1..240 32..257 545 48.1 Plus
Dana\GF13556-PA 290 GF13556-PA 1..92 32..125 172 31.9 Plus
Dana\GF12032-PA 181 GF12032-PA 60..167 32..138 145 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18428-PA 244 GG18428-PA 1..241 32..271 1002 80.1 Plus
Dere\GG22816-PA 285 GG22816-PA 1..92 32..125 172 31.9 Plus
Dere\GG20429-PA 181 GG20429-PA 60..167 32..138 155 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20967-PA 281 GH20967-PA 1..92 32..125 177 33 Plus
Dgri\GH17915-PA 181 GH17915-PA 1..142 43..199 161 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Reepl1-PA 240 CG11697-PA 1..240 32..271 1246 100 Plus
Reepl1-PB 222 CG11697-PB 1..222 32..271 1122 92.5 Plus
ReepA-PG 288 CG30193-PG 1..163 32..186 170 28.1 Plus
ReepA-PE 288 CG30193-PE 1..163 32..186 170 28.1 Plus
ReepA-PS 312 CG42678-PS 1..92 32..125 167 31.9 Plus
ReepA-PP 538 CG42678-PP 1..92 32..125 167 31.9 Plus
ReepA-PH 569 CG42678-PH 1..92 32..125 167 31.9 Plus
ReepA-PJ 570 CG42678-PJ 1..92 32..125 167 31.9 Plus
ReepA-PD 435 CG30193-PD 159..310 43..186 161 28.8 Plus
ReepA-PO 291 CG42678-PO 159..239 43..125 158 33.7 Plus
ReepA-PR 459 CG42678-PR 159..239 43..125 158 33.7 Plus
ReepA-PQ 685 CG42678-PQ 159..239 43..125 158 33.7 Plus
ReepA-PI 716 CG42678-PI 159..239 43..125 158 33.7 Plus
ReepB-PC 153 CG8331-PC 32..139 32..138 154 30 Plus
ReepB-PB 160 CG8331-PB 39..146 32..138 154 30 Plus
ReepB-PD 178 CG8331-PD 57..164 32..138 154 30 Plus
ReepB-PA 178 CG8331-PA 57..164 32..138 154 30 Plus
CG4960-PB 174 CG4960-PB 60..155 32..128 144 29.6 Plus
CG4960-PA 174 CG4960-PA 60..155 32..128 144 29.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16054-PA 306 GI16054-PA 1..150 43..193 212 31.2 Plus
Dmoj\GI21304-PA 281 GI21304-PA 1..92 32..125 171 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17205-PA 181 GL17205-PA 60..167 32..138 143 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30269-PA 550 GA30269-PA 1..92 32..125 187 34 Plus
Dpse\GA30269-PB 250 GA30269-PB 1..92 32..125 183 34 Plus
Dpse\GA30269-PG 693 GA30269-PG 155..235 43..125 173 34.9 Plus
Dpse\GA30269-PC 393 GA30269-PC 147..235 35..125 170 31.9 Plus
Dpse\GA20994-PA 181 GA20994-PA 60..167 32..138 143 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13092-PA 236 GM13092-PA 1..236 32..267 1083 90.7 Plus
Dsec\GM15973-PA 288 GM15973-PA 1..163 32..186 179 28.1 Plus
Dsec\GM21516-PA 181 GM21516-PA 60..167 32..138 148 30 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11027-PA 181 GD11027-PA 60..167 32..138 148 30 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15630-PA 320 GJ15630-PA 1..157 32..193 223 31.5 Plus
Dvir\GJ21570-PA 284 GJ21570-PA 1..92 32..125 172 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19241-PA 267 GK19241-PA 1..190 31..208 309 37.8 Plus
Dwil\GK19544-PA 281 GK19544-PA 1..92 32..125 171 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15946-PA 241 GE15946-PA 1..241 32..271 891 76.3 Plus
Dyak\GE14249-PA 286 GE14249-PA 1..166 32..189 180 28.2 Plus
Dyak\GE10663-PA 175 GE10663-PA 60..172 32..143 152 31.3 Plus
Dyak\GE13560-PA 181 GE13560-PA 20..167 3..138 148 26.7 Plus

IP07718.hyp Sequence

Translation from 2 to 817

> IP07718.hyp
KPNEQNREPNTQLYIYFLKIQNFKIIQNFQIMIYAIVIHILSLLVGCFYP
AFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSE
FKVLLLFWMLPSVGGGSEVIYEEFLRSFSCNESFDQVLGRITLEWGELVW
QQVCSVLSHLMVLADRYLLPSGHRPALQITPSIEDLVNDAIAKRQLEEKR
KQMGNLSDTINEVLGENIDLNMDLLHGSESDLLVIKEPISKPKERPIPPP
KPMRQPSSSNQQEMNLSSQFM*

IP07718.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11697-PA 240 CG11697-PA 1..240 32..271 1246 100 Plus
CG11697-PB 222 CG11697-PB 1..222 32..271 1122 92.5 Plus
CG42678-PG 288 CG30193-PG 1..163 32..186 170 28.1 Plus
CG42678-PE 288 CG30193-PE 1..163 32..186 170 28.1 Plus
CG42678-PS 312 CG42678-PS 1..92 32..125 167 31.9 Plus