Clone IP07722 Report

Search the DGRC for IP07722

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:22
Vector:pOT2
Associated Gene/TranscriptCG11977-RB
Protein status:IP07722.pep: gold
Preliminary Size:765
Sequenced Size:882

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11977 2005-01-01 Successful iPCR screen
CG11977 2008-04-29 Release 5.5 accounting
CG11977 2008-08-15 Release 5.9 accounting
CG11977 2008-12-18 5.12 accounting

Clone Sequence Records

IP07722.complete Sequence

882 bp (882 high quality bases) assembled on 2005-03-10

GenBank Submission: BT022643

> IP07722.complete
AAAGATGAATCTTTTGTGGGCTATAGTGATTGTGGCCGAACTGAAATGTC
ATACGGGCCATACTGTATTCCGAACTCGATGGCCCACATATGTACAGAAA
AAACACTATAATATTCCAGTAAAGCCACCCGATTACTGCAATGCAGACAT
TTGTCCGGCCAACAAGAAGCACATCACCTGCGGCTTCAAATTTTGGTCTA
CGAAATGCGGTAGAAATCACGAGGGCGTCAGGATGAGCGATTATCGCTAT
GATATCGTGAGGAATGTGAACAACTTTCGACGGAAGTTGGAATGGGGCCT
GGGGAATCTGCCCAGAGCGGTCAAATTTAAGAACATCAAGTGGGACGATG
AGCTGTCGGTGATGGCGATGCGGGTCTCTAATCAATGCTTGCAGCACACT
TTCTCACCCTGCGTGAATACGTTCCTCTACAAGGATGTGGGCGAGTCCTC
AGATTTCGTCAAGGTGCAGAACACTTCCAAGGGCTTCAACGTGATCAGCT
TCCTGAATATGTGGTTCGAATACCACAAGATGATGAAGCCCAGCTATGTG
AACAACTTTCCCAATATAGCCCCTCAGGATCGGCTCATTATCTTCGCCAA
TCTGATCTACGAGAAGAACAAGAAAATGGGCTGCGGAATGGTGAAGTCGG
GGCAGGGGCGCTTCCTGACCTGCCTCTTCGATAAGAAAATCAAGCCAAAC
CAGAAGCTTTACACCACTCGGTTGAATGATCCATTTCGCACAAATCGGAA
AACAAACGAAACAGAATCGATCCAATCGAATAGTAGTAGCACAGAAGCAA
TTGTAAATTTGAACACAGCGTATAAATAGTATTTGCATTGAATCCAATTC
AATTACTAAAAAAAAAAAAAAAAAAAAAAAAA

IP07722.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11977-RB 1038 CG11977-RB 112..972 1..861 4305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4823909..4824572 194..857 3290 99.7 Plus
chr3R 27901430 chr3R 4823591..4823714 1..124 605 99.2 Plus
chr3R 27901430 chr3R 4823772..4823845 120..193 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8998015..8998682 194..861 3340 100 Plus
3R 32079331 3R 8997697..8997820 1..124 620 100 Plus
3R 32079331 3R 8997878..8997951 120..193 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8738846..8739513 194..861 3340 100 Plus
3R 31820162 3R 8738528..8738651 1..124 620 100 Plus
3R 31820162 3R 8738709..8738782 120..193 370 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:45:35 has no hits.

IP07722.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:46:26 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4823591..4823714 1..124 99 -> Plus
chr3R 4823777..4823845 125..193 100 -> Plus
chr3R 4823909..4824572 194..857 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:20 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RA 61..765 125..829 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:53 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..825 5..829 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:30 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..825 5..829 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:47 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RA 61..765 125..829 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:42 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..825 5..829 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:22 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RA 61..765 125..829 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:53 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:30 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:47 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RA 61..765 125..829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:42 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
CG11977-RB 1..857 1..857 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:26 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8997697..8997820 1..124 100 -> Plus
3R 8997883..8997951 125..193 100 -> Plus
3R 8998015..8998678 194..857 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:26 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8997697..8997820 1..124 100 -> Plus
3R 8997883..8997951 125..193 100 -> Plus
3R 8998015..8998678 194..857 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:26 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8997697..8997820 1..124 100 -> Plus
3R 8997883..8997951 125..193 100 -> Plus
3R 8998015..8998678 194..857 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:30 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4823605..4823673 125..193 100 -> Plus
arm_3R 4823419..4823542 1..124 100 -> Plus
arm_3R 4823737..4824400 194..857 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:46 Download gff for IP07722.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8738846..8739509 194..857 100   Plus
3R 8738528..8738651 1..124 100 -> Plus
3R 8738714..8738782 125..193 100 -> Plus

IP07722.hyp Sequence

Translation from 0 to 828

> IP07722.hyp
KMNLLWAIVIVAELKCHTGHTVFRTRWPTYVQKKHYNIPVKPPDYCNADI
CPANKKHITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGL
GNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESS
DFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFAN
LIYEKNKKMGCGMVKSGQGRFLTCLFDKKIKPNQKLYTTRLNDPFRTNRK
TNETESIQSNSSSTEAIVNLNTAYK*

IP07722.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11977-PB 274 CG11977-PB 1..274 2..275 1498 100 Plus
CG34002-PB 350 CG34002-PB 27..258 44..258 183 24.7 Plus
Ag5r2-PA 254 CG9540-PA 20..195 44..215 151 25.8 Plus

IP07722.pep Sequence

Translation from 1 to 828

> IP07722.pep
KMNLLWAIVIVAELKCHTGHTVFRTRWPTYVQKKHYNIPVKPPDYCNADI
CPANKKHITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGL
GNLPRAVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESS
DFVKVQNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFAN
LIYEKNKKMGCGMVKSGQGRFLTCLFDKKIKPNQKLYTTRLNDPFRTNRK
TNETESIQSNSSSTEAIVNLNTAYK*

IP07722.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23841-PA 293 GF23841-PA 39..224 37..215 180 26.6 Plus
Dana\GF20496-PA 256 GF20496-PA 23..196 39..215 150 25.3 Plus
Dana\GF16741-PA 260 GF16741-PA 18..219 44..238 144 24.4 Plus
Dana\GF18253-PA 268 GF18253-PA 26..227 44..238 144 24.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14207-PA 258 GG14207-PA 1..253 2..268 1003 68.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16558-PA 261 GH16558-PA 28..226 44..237 156 25 Plus
Dgri\GH24944-PA 305 GH24944-PA 42..247 39..227 153 25 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11977-PB 274 CG11977-PB 1..274 2..275 1498 100 Plus
CG34002-PB 350 CG34002-PB 27..258 44..258 183 24.7 Plus
Ag5r2-PA 254 CG9540-PA 20..195 44..215 151 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22580-PA 254 GI22580-PA 30..247 22..237 317 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13578-PA 169 GL13578-PA 9..158 90..240 294 39.9 Plus
Dper\GL17454-PA 264 GL17454-PA 18..242 40..254 152 25.2 Plus
Dper\GL11847-PA 263 GL11847-PA 20..198 41..215 148 25.9 Plus
Dper\GL12570-PA 261 GL12570-PA 19..220 44..238 147 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26830-PA 252 GA26830-PA 1..241 2..240 462 38.5 Plus
Dpse\GA26195-PA 238 GA26195-PA 1..228 2..237 400 35 Plus
Dpse\GA24199-PA 264 GA24199-PA 18..242 40..254 152 25.2 Plus
Dpse\GA26382-PC 479 GA26382-PC 27..225 28..224 152 23.8 Plus
Dpse\GA22059-PA 263 GA22059-PA 20..198 41..215 148 25.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23776-PA 254 GM23776-PA 1..254 2..275 1219 83.6 Plus
Dsec\GM24819-PA 277 GM24819-PA 23..238 37..240 151 24.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15146-PA 197 GD15146-PA 1..197 78..275 945 90.4 Plus
Dsim\GD18586-PA 59 GD18586-PA 1..46 2..67 216 63.6 Plus
Dsim\GD12870-PA 277 GD12870-PA 23..238 37..240 150 24.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17434-PA 264 GJ17434-PA 40..263 21..240 421 40.1 Plus
Dvir\GJ11713-PA 265 GJ11713-PA 28..232 44..240 171 25.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19202-PA 267 GK19202-PA 25..267 23..268 403 36.3 Plus
Dwil\GK25699-PA 253 GK25699-PA 18..205 40..224 149 23.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25919-PA 280 GE25919-PA 1..261 2..263 1031 73.1 Plus
Dyak\GE13719-PA 263 GE13719-PA 21..200 40..215 162 25.9 Plus
Dyak\GE20280-PA 277 GE20280-PA 23..238 37..240 161 23.5 Plus
Dyak\GE14433-PA 296 GE14433-PA 19..223 38..237 157 23.8 Plus
Dyak\Ag5r-PA 256 GE16102-PA 21..255 44..271 147 24 Plus