Clone IP07723 Report

Search the DGRC for IP07723

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:23
Vector:pOT2
Associated Gene/TranscriptCG12078-RA
Protein status:IP07723.pep: gold
Preliminary Size:711
Sequenced Size:958

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12078 2005-01-01 Successful iPCR screen
CG12078 2008-04-29 Release 5.5 accounting
CG12078 2008-08-15 Release 5.9 accounting
CG12078 2008-12-18 5.12 accounting

Clone Sequence Records

IP07723.complete Sequence

958 bp (958 high quality bases) assembled on 2005-03-10

GenBank Submission: BT022639

> IP07723.complete
CTTATTGAAATTTTAGTATTATCGTTTTTTCCACTCTTTTCTATTCTAAT
TAATTTTGCATACATATTGTTCTTAAAATCATGTGATGCAGCTTAAAAGT
GAGTTCCTTATAATTTACGTTTTTGGATTGGCCACAATGGGTCTGATGAT
GGGCATCGCCTGTGTGGTGATTCCCCGATTGTGGTTCTTTCTGGAGAAGG
TTTATAGGGTTTTCGTGGAGTACACTCCCATCATTTACTTAAGTGAGGAT
CGCCTGTCGCCCGTTTCCAAAAGCCGACTGAGTCTCGTGGCCAGGAAGAC
ACTTGTCCTGGACATGGATAACACCATGATCACGTCGTGGTTTATAAAGA
GGGGAAAAAAACCGAAGAATATACCACGAATTGCGCATGACTTTAAGTTC
TACTTGCCGGCCTATGGAGCCACCATCTATGTCTACAAGCGCCCCTATTT
GGATCACTTCCTCGATCGCGTATCCAAGTGGTACGACCTGACTGTCTTCA
CATCCGGAGCCGAGATATATGCCTCTCCGATTCTCGACTTTCTGGACAGG
GGACGTGGCATCCTAAACAGTCGCCTCTACCGGCAGCATTGCATAGAACA
GTTTGGAAAGTGGTCCAAGTCCGTACTGCTGGCCTGCCCGGATTTGTCCA
ATGTTGTGCTGCTGGACAACTCCAGCACGGAGTGCAGTTTCAATGCGGAA
AACGCCATTCTCATCAAGTCCTATGAAATCGGCTGTCGCGACGAGGCCCT
CATCAATTTGTTACCTTTTCTGGACGCCCTGCGATTCATGAAGGATGTGC
GATCGATGCTCAAACGTTGCACTCGCTTCGAAAGTTTTGCTCAGTGAGAT
GATGTTGGTTGTTTGTTTTTTTTTTTTCTTTTTTTGGGTTCTATTCATTT
ATTTGTTAAATTTTAAAGCACTGAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

IP07723.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12078.a 1211 CG12078.a 240..1164 1..925 4625 100 Plus
CG12078-RA 1022 CG12078-RA 51..975 1..925 4625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3242678..3243483 923..118 4030 100 Minus
chr3L 24539361 chr3L 3243551..3243667 117..1 585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3243272..3244079 925..118 4040 100 Minus
3L 28110227 3L 3244147..3244263 117..1 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3243272..3244079 925..118 4040 100 Minus
3L 28103327 3L 3244147..3244263 117..1 585 100 Minus
Blast to na_te.dros performed 2019-03-15 23:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 797..865 849..917 129 65.2 Plus

IP07723.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:49:48 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3242678..3243483 118..923 100 <- Minus
chr3L 3243551..3243667 1..117 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:21 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..762 86..847 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:54 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..762 86..847 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:39 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..762 86..847 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:50 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..762 86..847 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:48:45 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..762 86..847 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:24 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:54 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:39 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 32..954 1..923 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:51 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 1..923 1..923 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:48:45 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
CG12078-RA 32..954 1..923 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:49:48 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3243274..3244079 118..923 100 <- Minus
3L 3244147..3244263 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:49:48 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3243274..3244079 118..923 100 <- Minus
3L 3244147..3244263 1..117 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:49:48 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3243274..3244079 118..923 100 <- Minus
3L 3244147..3244263 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:39 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3243274..3244079 118..923 100 <- Minus
arm_3L 3244147..3244263 1..117 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:47 Download gff for IP07723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3243274..3244079 118..923 100 <- Minus
3L 3244147..3244263 1..117 100   Minus

IP07723.pep Sequence

Translation from 85 to 846

> IP07723.pep
MQLKSEFLIIYVFGLATMGLMMGIACVVIPRLWFFLEKVYRVFVEYTPII
YLSEDRLSPVSKSRLSLVARKTLVLDMDNTMITSWFIKRGKKPKNIPRIA
HDFKFYLPAYGATIYVYKRPYLDHFLDRVSKWYDLTVFTSGAEIYASPIL
DFLDRGRGILNSRLYRQHCIEQFGKWSKSVLLACPDLSNVVLLDNSSTEC
SFNAENAILIKSYEIGCRDEALINLLPFLDALRFMKDVRSMLKRCTRFES
FAQ*

IP07723.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24377-PA 264 GF24377-PA 19..248 24..249 663 54.3 Plus
Dana\GF21841-PA 218 GF21841-PA 7..210 41..244 442 47.1 Plus
Dana\GF12569-PA 282 GF12569-PA 82..277 57..244 384 43 Plus
Dana\GF10364-PA 329 GF10364-PA 83..253 64..242 222 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14268-PA 260 GG14268-PA 1..252 1..252 1099 82.1 Plus
Dere\GG17544-PA 243 GG17544-PA 25..235 34..244 448 46 Plus
Dere\GG10624-PA 294 GG10624-PA 82..278 57..244 358 41.1 Plus
Dere\GG13507-PA 324 GG13507-PA 83..253 64..242 219 30.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12888-PA 243 GH12888-PA 25..235 34..244 464 46.5 Plus
Dgri\GH21358-PA 294 GH21358-PA 73..287 38..244 390 41.7 Plus
Dgri\GH16757-PA 341 GH16757-PA 81..251 64..242 218 30.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG12078-PA 253 CG12078-PA 1..253 1..253 1316 100 Plus
CG12078-PB 236 CG12078-PB 1..236 18..253 1234 100 Plus
Dd-PA 243 CG1696-PA 14..235 27..244 445 44.2 Plus
Dd-PB 240 CG1696-PB 44..232 57..244 422 48.4 Plus
CG8584-PA 293 CG8584-PA 63..277 37..244 370 40.3 Plus
CG5830-PA 329 CG5830-PA 83..253 64..242 229 30.7 Plus
CG5830-PB 352 CG5830-PB 106..276 64..242 229 30.7 Plus
Dd-PC 182 CG1696-PC 14..118 27..127 165 39.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12759-PA 245 GI12759-PA 1..224 44..252 586 53.6 Plus
Dmoj\GI14442-PA 243 GI14442-PA 19..235 28..244 460 45.7 Plus
Dmoj\GI20773-PA 313 GI20773-PA 83..303 32..244 387 41.9 Plus
Dmoj\GI13418-PA 331 GI13418-PA 81..251 64..242 214 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19342-PA 274 GL19342-PA 54..259 51..251 509 50 Plus
Dper\GL17365-PA 286 GL17365-PA 93..281 64..244 375 43.9 Plus
Dper\GL16570-PA 175 GL16570-PA 38..167 115..244 331 50 Plus
Dper\GL12819-PA 333 GL12819-PA 83..253 64..242 223 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25924-PA 306 GA25924-PA 86..291 51..251 509 50.5 Plus
Dpse\GA14238-PA 243 GA14238-PA 25..235 34..244 448 46 Plus
Dpse\GA21180-PA 286 GA21180-PA 93..281 64..244 370 43.4 Plus
Dpse\GA19163-PA 335 GA19163-PA 83..253 64..242 223 30.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14061-PA 253 GM14061-PA 1..253 1..253 1216 90.1 Plus
Dsec\GM22628-PA 243 GM22628-PA 25..235 34..244 448 46 Plus
Dsec\GM20669-PA 293 GM20669-PA 63..277 37..244 382 40.7 Plus
Dsec\GM24453-PA 412 GM24453-PA 164..334 64..242 219 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13336-PA 253 GD13336-PA 1..253 1..253 1193 88.9 Plus
Dsim\GD10142-PA 623 GD10142-PA 393..607 37..244 377 41.2 Plus
Dsim\GD24432-PA 139 GD24432-PA 7..139 41..173 298 48.2 Plus
Dsim\GD15269-PA 212 GD15269-PA 63..202 37..169 241 39.7 Plus
Dsim\GD12523-PA 331 GD12523-PA 83..253 64..242 221 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15525-PA 288 GJ15525-PA 1..264 1..249 598 49.2 Plus
Dvir\GJ18780-PA 243 GJ18780-PA 25..235 34..244 454 45.6 Plus
Dvir\GJ20507-PA 305 GJ20507-PA 79..296 35..244 404 42.5 Plus
Dvir\GJ11778-PA 329 GJ11778-PA 80..250 64..242 218 30.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16309-PA 243 GK16309-PA 25..235 34..244 436 45.6 Plus
Dwil\GK23052-PA 275 GK23052-PA 21..273 3..246 373 39.4 Plus
Dwil\GK23622-PA 325 GK23622-PA 84..254 64..242 227 31.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20696-PA 260 GE20696-PA 1..252 1..252 1069 83.3 Plus
Dyak\GE15304-PA 243 GE15304-PA 25..235 34..244 448 46 Plus
Dyak\GE22820-PA 294 GE22820-PA 79..278 54..244 363 40.5 Plus
Dyak\GE23126-PA 325 GE23126-PA 83..253 64..242 221 30.7 Plus

IP07723.hyp Sequence

Translation from 85 to 846

> IP07723.hyp
MQLKSEFLIIYVFGLATMGLMMGIACVVIPRLWFFLEKVYRVFVEYTPII
YLSEDRLSPVSKSRLSLVARKTLVLDMDNTMITSWFIKRGKKPKNIPRIA
HDFKFYLPAYGATIYVYKRPYLDHFLDRVSKWYDLTVFTSGAEIYASPIL
DFLDRGRGILNSRLYRQHCIEQFGKWSKSVLLACPDLSNVVLLDNSSTEC
SFNAENAILIKSYEIGCRDEALINLLPFLDALRFMKDVRSMLKRCTRFES
FAQ*

IP07723.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12078-PA 253 CG12078-PA 1..253 1..253 1316 100 Plus
CG12078-PB 236 CG12078-PB 1..236 18..253 1234 100 Plus
Dd-PA 243 CG1696-PA 14..235 27..244 445 44.2 Plus
Dd-PB 240 CG1696-PB 44..232 57..244 422 48.4 Plus
CG8584-PA 293 CG8584-PA 63..277 37..244 370 40.3 Plus