Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP07736.complete Sequence
855 bp (855 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022627
> IP07736.complete
AAAATATGGAGGACAGGGCTTCTTCGATTGACGAGTCGATCGGGCATAGC
AAGCCGGCCATTTGTCCGTTAGCCGATTGTCAGGCTGTGGTGGAGCATAC
CCACTTGCTGCGCCACATGATAACCAAACATTTGGATCCGCGGGCGCGAA
CTTTGCCCTTTCAACTGCGCCTGCGCGAAGTGTCGACAGGTCAGCGCACT
CTGCTGATGCTCCCCTATCGCCAGCTGATCATTGACAACGATCAATGCTT
GGCCGTGCTGAATTGGAGCTCCGTGTCCCAAGGTGACCTTACGGCACCGC
AGTTGGACCTGCCGCCATGCCACCAAATGTTAACCTATCACCTGCCCATT
TTGGTGATGGTCTGCAGGACCACGTGGAAATCCCTCTTAAAGCAGATCGA
TGAAAAGGACATGCAAGAAACCAGGGACGTAACGGCAGAATGGGGCGGTG
TCTATCTGTTTTGGCTCCTTTCACCCTTAACGCGGCGTCCCATTTATGCA
AATTTAGCCCTACTGAATAGCCAAATTCAGAGCGTCTATAGGCGGAATCG
TCGGCGGATACGCAACTTTGCCAGTCGGATGCCCATTAGACAGTTCATAA
ACGGGCTAGATCCATACTTTGTCAGCATCAACGAGGATCAGCTCGACGAG
CTGTGCAATGGCGGTGGCAACCGGTTCTCCATCTACTTCGAGGTTATAAT
CGAGGGCGTAATGTCATAGACTTAACTTCTTAACCCCATCAATATCATTC
TCATAAAGGATTGTTTTATCATTATCTACATAATTGGGCATGCGAACATT
ATAGAAATAAAATAAAATCTCAAGTGAACACAATGAAAAAAAAAAAAAAA
AAAAA
IP07736.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG12682-RA | 714 | CG12682-RA | 1..714 | 6..719 | 3570 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:13:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| chrX | 22417052 | chrX | 4718738..4719572 | 1..835 | 4010 | 98.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:13:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 4825999..4826834 | 1..836 | 4180 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23527363 | X | 4834097..4834932 | 1..836 | 4180 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 16:13:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 297 | 6995 | 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). | 6147..6191 | 791..835 | 108 | 71.1 | Plus |
IP07736.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:14:19 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| chrX | 4718738..4719572 | 1..835 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:25 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:27 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:49 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:53 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:23:01 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:39 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:27 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 26..860 | 1..835 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:49 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 26..860 | 1..835 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:53 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 1..714 | 6..719 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:23:01 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG12682-RA | 26..860 | 1..835 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:19 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 4825999..4826833 | 1..835 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:19 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 4825999..4826833 | 1..835 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:19 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 4825999..4826833 | 1..835 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:49 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 4720032..4720866 | 1..835 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:26 Download gff for
IP07736.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 4834097..4834931 | 1..835 | 100 | | Plus |
IP07736.pep Sequence
Translation from 2 to 718
> IP07736.pep
NMEDRASSIDESIGHSKPAICPLADCQAVVEHTHLLRHMITKHLDPRART
LPFQLRLREVSTGQRTLLMLPYRQLIIDNDQCLAVLNWSSVSQGDLTAPQ
LDLPPCHQMLTYHLPILVMVCRTTWKSLLKQIDEKDMQETRDVTAEWGGV
YLFWLLSPLTRRPIYANLALLNSQIQSVYRRNRRRIRNFASRMPIRQFIN
GLDPYFVSINEDQLDELCNGGGNRFSIYFEVIIEGVMS*
IP07736.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dana\GF20346-PA | 254 | GF20346-PA | 8..250 | 6..235 | 692 | 58.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG18730-PA | 238 | GG18730-PA | 1..238 | 2..238 | 912 | 76.2 | Plus |
| Dere\GG17568-PA | 682 | GG17568-PA | 449..609 | 13..175 | 153 | 28.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG12682-PA | 237 | CG12682-PA | 1..237 | 2..238 | 1247 | 100 | Plus |
| CG11227-PA | 753 | CG11227-PA | 542..747 | 21..234 | 154 | 25 | Plus |
| CG11227-PB | 764 | CG11227-PB | 553..758 | 21..234 | 154 | 25 | Plus |
| boil-PA | 450 | CG12681-PA | 42..249 | 18..226 | 151 | 26.6 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dmoj\GI15690-PA | 243 | GI15690-PA | 40..242 | 21..235 | 341 | 39 | Plus |
| Dmoj\GI11673-PA | 292 | GI11673-PA | 2..188 | 18..214 | 176 | 26.7 | Plus |
| Dmoj\GI11677-PA | 344 | GI11677-PA | 47..236 | 18..207 | 157 | 25.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM12368-PA | 199 | GM12368-PA | 4..133 | 16..143 | 598 | 87.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD16707-PA | 229 | GD16707-PA | 4..228 | 16..237 | 980 | 87.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\GJ19214-PA | 226 | GJ19214-PA | 9..224 | 14..235 | 459 | 40.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dwil\GK18843-PA | 228 | GK18843-PA | 11..223 | 19..235 | 551 | 50.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE16367-PA | 236 | GE16367-PA | 1..236 | 2..238 | 958 | 78.5 | Plus |
IP07736.hyp Sequence
Translation from 2 to 718
> IP07736.hyp
NMEDRASSIDESIGHSKPAICPLADCQAVVEHTHLLRHMITKHLDPRART
LPFQLRLREVSTGQRTLLMLPYRQLIIDNDQCLAVLNWSSVSQGDLTAPQ
LDLPPCHQMLTYHLPILVMVCRTTWKSLLKQIDEKDMQETRDVTAEWGGV
YLFWLLSPLTRRPIYANLALLNSQIQSVYRRNRRRIRNFASRMPIRQFIN
GLDPYFVSINEDQLDELCNGGGNRFSIYFEVIIEGVMS*
IP07736.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG12682-PA | 237 | CG12682-PA | 1..237 | 2..238 | 1247 | 100 | Plus |
| CG11227-PA | 753 | CG11227-PA | 542..747 | 21..234 | 154 | 25 | Plus |
| CG11227-PB | 764 | CG11227-PB | 553..758 | 21..234 | 154 | 25 | Plus |
| CG12681-PA | 450 | CG12681-PA | 42..249 | 18..226 | 151 | 26.6 | Plus |
