BDGP Sequence Production Resources |
Search the DGRC for IP07752
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 77 |
Well: | 52 |
Vector: | pOT2 |
Associated Gene/Transcript | Sgf11-RB |
Protein status: | IP07752.pep: gold |
Preliminary Size: | 672 |
Sequenced Size: | 756 |
Gene | Date | Evidence |
---|---|---|
CG13379 | 2005-01-01 | Successful iPCR screen |
CG13379 | 2008-04-29 | Release 5.5 accounting |
CG13379 | 2008-04-29 | Picked prior to 5.5 |
Sgf11 | 2008-08-15 | Release 5.9 accounting |
Sgf11 | 2008-12-18 | 5.12 accounting |
756 bp (756 high quality bases) assembled on 2005-03-10
GenBank Submission: BT022619
> IP07752.complete CAACAACCGGCATGCCAAACAAATCTTCCAGAGCAGACAGGAAGACAGCC AGAAGCAAATAGATATAGTGTTTGCGCCAACTATTATGTCTGCAGCCAAC ATGCCGACGACAACAGGAGCTCAGGGATCGGGAAACCAAGTTCCCACAAC TAGCACTACGATTGTAAACCACTTCCGGGAGTTGATCAAGGAACCGAAGA ACCTCGACGAGGCGGCCAACTATCTGTACCAGTCGCTGCTCGACGACGCC GTAGTCGGAATCTTTAACGAGACACATCATCTGCGAAAGTCAGGGAATCT GGCCGCCCTGGACGGAGTGCCGGAGGACTCAACCTATCGAATGTGCGAGA TGCCCAACCTGGACATATTCGGCATCTCAACGGCCAAAAAGCCAATGGAC TGCACCTGCCCCAACTGTGATCGCCTGGTGGCCGCCGCCCGCTTCGCCCC GCACCTGGAAAAGTGCATGGGCATGGGTCGTATCTCGTCGCGAATTGCCT CTCGTCGCTTGGCCACCAAAGAGGGCGCCACATCCGCCCACCTGCACTCT TCGGGAAATACCGGAGGCACTGATGATGAGGATGACGTGGACTGGTCGTC CGACAAGCGTCGAAAGAAATCAAACCAGAACTCAAGGAACAACGGCTCCA AGAAGAACAATGGCAAAACCTTTTAGTCAGAGCTAACAATCATTTTCGTA GTTTATTCTGCCATAAAAGTACACCTTTAAATCAGTCAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sgf11-RB | 751 | Sgf11-RB | 18..751 | 1..734 | 3670 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18670717..18671453 | 737..1 | 3685 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 18681036..18681773 | 738..1 | 3690 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18674136..18674873 | 738..1 | 3690 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18670717..18671453 | 1..737 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 1..591 | 86..676 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 1..591 | 86..676 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 1..591 | 86..676 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 1..591 | 86..676 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 1..591 | 86..676 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 18..751 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 18..751 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 64..800 | 1..737 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 18..751 | 1..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sgf11-RB | 64..800 | 1..737 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18681037..18681773 | 1..737 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18681037..18681773 | 1..737 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18681037..18681773 | 1..737 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18674137..18674873 | 1..737 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18674137..18674873 | 1..737 | 100 | Minus |
Translation from 0 to 675
> IP07752.hyp NNRHAKQIFQSRQEDSQKQIDIVFAPTIMSAANMPTTTGAQGSGNQVPTT STTIVNHFRELIKEPKNLDEAANYLYQSLLDDAVVGIFNETHHLRKSGNL AALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAP HLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSS DKRRKKSNQNSRNNGSKKNNGKTF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sgf11-PB | 196 | CG13379-PB | 1..196 | 29..224 | 1034 | 100 | Plus |
Translation from 1 to 675
> IP07752.pep NNRHAKQIFQSRQEDSQKQIDIVFAPTIMSAANMPTTTGAQGSGNQVPTT STTIVNHFRELIKEPKNLDEAANYLYQSLLDDAVVGIFNETHHLRKSGNL AALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAP HLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSS DKRRKKSNQNSRNNGSKKNNGKTF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10810-PA | 191 | GF10810-PA | 1..191 | 34..224 | 832 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15731-PA | 191 | GG15731-PA | 1..191 | 34..224 | 1014 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17199-PA | 211 | GH17199-PA | 27..211 | 49..224 | 772 | 80 | Plus |
Dgri\GH14369-PA | 211 | GH14369-PA | 27..211 | 49..224 | 772 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sgf11-PB | 196 | CG13379-PB | 1..196 | 29..224 | 1034 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11309-PA | 211 | GI11309-PA | 1..211 | 29..224 | 766 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22692-PA | 196 | GL22692-PA | 1..196 | 34..224 | 774 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12241-PA | 196 | GA12241-PA | 1..196 | 34..224 | 774 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14927-PA | 177 | GM14927-PA | 1..177 | 34..224 | 927 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12333-PA | 191 | GD12333-PA | 1..191 | 34..224 | 1028 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14101-PA | 189 | GJ14101-PA | 3..189 | 46..224 | 766 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10782-PA | 241 | GK10782-PA | 55..241 | 54..224 | 734 | 74.9 | Plus |
Dwil\GK15061-PA | 209 | GK15061-PA | 10..203 | 35..219 | 460 | 48.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22063-PA | 191 | GE22063-PA | 1..191 | 34..224 | 1003 | 95.8 | Plus |