Clone IP07752 Report

Search the DGRC for IP07752

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:52
Vector:pOT2
Associated Gene/TranscriptSgf11-RB
Protein status:IP07752.pep: gold
Preliminary Size:672
Sequenced Size:756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13379 2005-01-01 Successful iPCR screen
CG13379 2008-04-29 Release 5.5 accounting
CG13379 2008-04-29 Picked prior to 5.5
Sgf11 2008-08-15 Release 5.9 accounting
Sgf11 2008-12-18 5.12 accounting

Clone Sequence Records

IP07752.complete Sequence

756 bp (756 high quality bases) assembled on 2005-03-10

GenBank Submission: BT022619

> IP07752.complete
CAACAACCGGCATGCCAAACAAATCTTCCAGAGCAGACAGGAAGACAGCC
AGAAGCAAATAGATATAGTGTTTGCGCCAACTATTATGTCTGCAGCCAAC
ATGCCGACGACAACAGGAGCTCAGGGATCGGGAAACCAAGTTCCCACAAC
TAGCACTACGATTGTAAACCACTTCCGGGAGTTGATCAAGGAACCGAAGA
ACCTCGACGAGGCGGCCAACTATCTGTACCAGTCGCTGCTCGACGACGCC
GTAGTCGGAATCTTTAACGAGACACATCATCTGCGAAAGTCAGGGAATCT
GGCCGCCCTGGACGGAGTGCCGGAGGACTCAACCTATCGAATGTGCGAGA
TGCCCAACCTGGACATATTCGGCATCTCAACGGCCAAAAAGCCAATGGAC
TGCACCTGCCCCAACTGTGATCGCCTGGTGGCCGCCGCCCGCTTCGCCCC
GCACCTGGAAAAGTGCATGGGCATGGGTCGTATCTCGTCGCGAATTGCCT
CTCGTCGCTTGGCCACCAAAGAGGGCGCCACATCCGCCCACCTGCACTCT
TCGGGAAATACCGGAGGCACTGATGATGAGGATGACGTGGACTGGTCGTC
CGACAAGCGTCGAAAGAAATCAAACCAGAACTCAAGGAACAACGGCTCCA
AGAAGAACAATGGCAAAACCTTTTAGTCAGAGCTAACAATCATTTTCGTA
GTTTATTCTGCCATAAAAGTACACCTTTAAATCAGTCAAAAAAAAAAAAA
AAAAAA

IP07752.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sgf11-RB 751 Sgf11-RB 18..751 1..734 3670 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18670717..18671453 737..1 3685 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18681036..18681773 738..1 3690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18674136..18674873 738..1 3690 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:35:42 has no hits.

IP07752.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:36:48 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18670717..18671453 1..737 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:31 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 1..591 86..676 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:42 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 1..591 86..676 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:46:35 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 1..591 86..676 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:37 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 1..591 86..676 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:05:06 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 1..591 86..676 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:58:00 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 18..751 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:41 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 18..751 1..734 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:46:35 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 64..800 1..737 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:37 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 18..751 1..734 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:05:06 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf11-RB 64..800 1..737 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:36:48 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18681037..18681773 1..737 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:36:48 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18681037..18681773 1..737 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:36:48 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18681037..18681773 1..737 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:46:35 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18674137..18674873 1..737 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:34 Download gff for IP07752.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18674137..18674873 1..737 100   Minus

IP07752.hyp Sequence

Translation from 0 to 675

> IP07752.hyp
NNRHAKQIFQSRQEDSQKQIDIVFAPTIMSAANMPTTTGAQGSGNQVPTT
STTIVNHFRELIKEPKNLDEAANYLYQSLLDDAVVGIFNETHHLRKSGNL
AALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAP
HLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSS
DKRRKKSNQNSRNNGSKKNNGKTF*

IP07752.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Sgf11-PB 196 CG13379-PB 1..196 29..224 1034 100 Plus

IP07752.pep Sequence

Translation from 1 to 675

> IP07752.pep
NNRHAKQIFQSRQEDSQKQIDIVFAPTIMSAANMPTTTGAQGSGNQVPTT
STTIVNHFRELIKEPKNLDEAANYLYQSLLDDAVVGIFNETHHLRKSGNL
AALDGVPEDSTYRMCEMPNLDIFGISTAKKPMDCTCPNCDRLVAAARFAP
HLEKCMGMGRISSRIASRRLATKEGATSAHLHSSGNTGGTDDEDDVDWSS
DKRRKKSNQNSRNNGSKKNNGKTF*

IP07752.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10810-PA 191 GF10810-PA 1..191 34..224 832 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15731-PA 191 GG15731-PA 1..191 34..224 1014 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17199-PA 211 GH17199-PA 27..211 49..224 772 80 Plus
Dgri\GH14369-PA 211 GH14369-PA 27..211 49..224 772 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Sgf11-PB 196 CG13379-PB 1..196 29..224 1034 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11309-PA 211 GI11309-PA 1..211 29..224 766 72 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22692-PA 196 GL22692-PA 1..196 34..224 774 74 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12241-PA 196 GA12241-PA 1..196 34..224 774 74 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14927-PA 177 GM14927-PA 1..177 34..224 927 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12333-PA 191 GD12333-PA 1..191 34..224 1028 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14101-PA 189 GJ14101-PA 3..189 46..224 766 78.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10782-PA 241 GK10782-PA 55..241 54..224 734 74.9 Plus
Dwil\GK15061-PA 209 GK15061-PA 10..203 35..219 460 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22063-PA 191 GE22063-PA 1..191 34..224 1003 95.8 Plus