Clone IP07763 Report

Search the DGRC for IP07763

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:63
Vector:pOT2
Associated Gene/TranscriptCG13891-RA
Protein status:IP07763.pep: gold
Preliminary Size:662
Sequenced Size:833

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13891-RA 2009-01-21 est gleaning

Clone Sequence Records

IP07763.complete Sequence

833 bp assembled on 2009-06-08

GenBank Submission: BT088776.1

> IP07763.complete
AAATGGTCTAGGGAACTTGCTACAAAATCAAGTGTGTATATAATAATGAT
CTAGAAACCGGAGGGCAACGGCGACGAATAGGGGCATTATCGGGACCACC
TGGAGGCCGCTGAAGGGACCTAACACTACCTAAAATAAACAGCTTCGTCA
TGGCGGCTCTGGTGGACGAAAGCAACTACGCCTATGTGAAGCAGGTGGCT
CTGGACTGGCGGGAGCTGGTGCGCGAGAAGCGCAAGAGCAATATCTTTTC
GCCCACGATAAGCATGCAGGCGGTTGATTCCCAACAGCCGATAGGGGACA
CAAGGTCGCGGACACAGTCGATGATTCCGGCCGAGAGACGCGAGTCCAGC
TTCTACCGGCACCGCTTCTCGCAGCAGGCCAAGCCCGTGGAGATCGAGTG
CCAGGAGGTCGGATCAATGGAGCCAGACCGCATTCGGGTTAGCGGAGACA
TTCTGCTCTACATCTACCAACCGATTTTTGTGTCAAACACAGTGATGGCC
TCCATTCAAGCCTGGTCGCCCAGTGAAATAAGCATAACGTCGTCCAAACT
GAAGGAGCCTATTAGAGAAGAGAACCCCACGGCTAAGGTGGAATCCGATC
CATCACCCGAGCCCATGTCGCCGTAATCATGAAATCCGGTGATTCTTTTT
ATACCATCCTAATCGTTTAGCACTTGTGAGCAATAAAGAAAATGTAAATC
TGACCATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP07763.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13891-RA 746 CG13891-RA 37..746 1..710 3550 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 433059..433768 710..1 3505 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 433144..433855 712..1 3560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 433144..433855 712..1 3560 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:17:09 has no hits.

IP07763.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:17:51 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 433059..433768 1..710 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:06 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 1..477 150..626 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:05 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 1..477 150..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:47 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 1..477 150..626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:40 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 1..477 150..626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 14:26:14 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 37..662 1..626 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:05 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 52..761 1..710 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:47 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 52..761 1..710 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:40 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
CG13891-RA 52..761 1..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:51 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
3L 433146..433855 1..710 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:51 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
3L 433146..433855 1..710 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:51 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
3L 433146..433855 1..710 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:47 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 433146..433855 1..710 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:30 Download gff for IP07763.complete
Subject Subject Range Query Range Percent Splice Strand
3L 433146..433855 1..710 100   Minus

IP07763.pep Sequence

Translation from 149 to 625

> IP07763.pep
MAALVDESNYAYVKQVALDWRELVREKRKSNIFSPTISMQAVDSQQPIGD
TRSRTQSMIPAERRESSFYRHRFSQQAKPVEIECQEVGSMEPDRIRVSGD
ILLYIYQPIFVSNTVMASIQAWSPSEISITSSKLKEPIREENPTAKVESD
PSPEPMSP*

IP07763.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24888-PA 158 GF24888-PA 2..110 3..112 269 50.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14659-PA 157 GG14659-PA 2..157 3..158 657 79.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13891-PA 158 CG13891-PA 1..158 1..158 801 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12605-PA 140 GA12605-PA 28..129 6..112 136 37.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14275-PA 157 GM14275-PA 2..157 3..158 740 91.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25704-PA 157 GD25704-PA 2..157 3..158 751 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21019-PA 157 GE21019-PA 2..157 3..158 605 76.3 Plus

IP07763.hyp Sequence

Translation from 149 to 625

> IP07763.hyp
MAALVDESNYAYVKQVALDWRELVREKRKSNIFSPTISMQAVDSQQPIGD
TRSRTQSMIPAERRESSFYRHRFSQQAKPVEIECQEVGSMEPDRIRVSGD
ILLYIYQPIFVSNTVMASIQAWSPSEISITSSKLKEPIREENPTAKVESD
PSPEPMSP*

IP07763.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13891-PA 158 CG13891-PA 1..158 1..158 801 100 Plus