Clone IP07779 Report

Search the DGRC for IP07779

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:79
Vector:pOT2
Associated Gene/TranscriptCG14269-RA
Protein status:IP07779.pep: gold
Preliminary Size:680
Sequenced Size:854

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14269 2005-01-01 Successful iPCR screen
CG14269 2008-04-29 Release 5.5 accounting
CG14269 2008-08-15 Release 5.9 accounting
CG14269 2008-12-18 5.12 accounting

Clone Sequence Records

IP07779.complete Sequence

854 bp (854 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022603

> IP07779.complete
TAAAAGCGAGTTGACTAGCTCAAAATTTTTCGTTCGTTTCGTCGCTCTCG
AAAATCGAAAATCGAAAATCAGAGGGGACAAACTATGTCAGAAGGGTCAG
TTGAAGAGTAACAGATTTGAACGCACTAATTGAATTGAAAACTAGTTATG
CTGGTCATGGACGCATTGTTTAACAGCCTATTGGTGGTCAGTTCCGGCTA
TGCGATCTACACTCTCCATCCAATGGAAACACCCTATGGCTATGCAACAG
CGGCCTTGAGCCTGGTCCATGGAATTTTGGGAATGGTGCGAGCGGCGAGC
AACGACGATGACGAATGCAATCGGGTGCGATTGATTACGTCGGGCATCAT
GGAGATAGTACCGCTGCCCCTGACCAATATGGAGCTCTATCTGAAGTCCA
CCAATCCGGGCTTGGCTTTGGCGCACACATGTTTTGTGGTGCCATTAGTC
TACGATATGTTGGCCAAAGTGGTTGACACCGAGGATACCGTAACGGAGAC
CCTTAAGGAACTAACACTGTTGGGCAACGTTGTGTCCATGCTCTTTTTGG
GCGTCAACGAGTCGAATAATATGTACGGCATCTTGGCTGCCATCGCTTTT
GGTGCTCGATACGGTTCCGCTTTTCTCGACTACTACTGGAAGGGATTAGG
TGCCGAATTCACCCTACTGGCCCACTCCATGTTTGTCCTACTGATGACGA
TGACCCTTTCGGCGAAATGAAGACCAATAGACCTCCCAGAATATAACCTA
TCCGCATTCAAGGCCAGCGGTTAGGTTCGTTGGCTTTCAGCTCAATAAAC
TTGCAATTAATGTTGGCAAATTAAAATGCAAAAATAAAAAAAAAAAAAAA
AAAA

IP07779.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14269-RA 835 CG14269-RA 1..835 1..835 4160 99.8 Plus
CG14269.a 804 CG14269.a 95..788 145..838 3455 99.8 Plus
CG14269.a 804 CG14269.a 1..95 1..95 475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3328516..3329334 826..1 3900 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3434970..3435807 838..1 4175 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3443068..3443905 838..1 4175 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 10:15:01 has no hits.

IP07779.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:15:53 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3328506..3329334 1..835 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:39 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..573 148..720 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:28 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..573 148..720 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:44 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..573 148..720 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:54 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..573 148..720 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:54 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..573 148..720 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:41 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..680 41..720 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:28 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..835 1..835 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:44 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..835 1..835 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:54 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..680 41..720 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:54 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
CG14269-RA 1..835 1..835 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:53 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
X 3434973..3435807 1..835 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:53 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
X 3434973..3435807 1..835 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:15:53 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
X 3434973..3435807 1..835 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:44 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3329006..3329840 1..835 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:28 Download gff for IP07779.complete
Subject Subject Range Query Range Percent Splice Strand
X 3443071..3443905 1..835 99   Minus

IP07779.pep Sequence

Translation from 147 to 719

> IP07779.pep
MLVMDALFNSLLVVSSGYAIYTLHPMETPYGYATAALSLVHGILGMVRAA
SNDDDECNRVRLITSGIMEIVPLPLTNMELYLKSTNPGLALAHTCFVVPL
VYDMLAKVVDTEDTVTETLKELTLLGNVVSMLFLGVNESNNMYGILAAIA
FGARYGSAFLDYYWKGLGAEFTLLAHSMFVLLMTMTLSAK*

IP07779.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19608-PA 190 GF19608-PA 1..190 1..190 840 83.2 Plus
Dana\GF20145-PA 190 GF20145-PA 1..188 1..188 414 41 Plus
Dana\GF21789-PA 200 GF21789-PA 7..199 4..190 271 33.5 Plus
Dana\GF21842-PA 203 GF21842-PA 13..194 7..183 269 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18584-PA 189 GG18584-PA 1..189 1..190 839 84.2 Plus
Dere\GG10445-PA 190 GG10445-PA 1..188 1..188 360 39.9 Plus
Dere\GG18583-PA 200 GG18583-PA 7..199 4..190 286 33.5 Plus
Dere\GG10502-PA 205 GG10502-PA 13..194 7..183 265 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12189-PA 191 GH12189-PA 1..190 1..190 738 71.6 Plus
Dgri\GH16031-PA 188 GH16031-PA 10..188 11..190 319 35.6 Plus
Dgri\GH12188-PA 198 GH12188-PA 7..197 4..190 290 32.3 Plus
Dgri\GH12187-PA 198 GH12187-PA 7..197 4..190 290 32.3 Plus
Dgri\GH10209-PA 201 GH10209-PA 13..156 7..143 163 32.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14269-PB 190 CG14269-PB 1..190 1..190 960 100 Plus
CG14269-PA 190 CG14269-PA 1..190 1..190 960 100 Plus
CG12679-PA 190 CG12679-PA 1..188 1..188 395 42.6 Plus
CG16782-PA 200 CG16782-PA 7..199 4..190 290 32.5 Plus
CG14537-PA 203 CG14537-PA 13..194 7..183 238 32.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14347-PA 191 GI14347-PA 1..190 1..190 765 74.2 Plus
Dmoj\GI14346-PA 197 GI14346-PA 7..196 4..190 307 33 Plus
Dmoj\GI12294-PA 187 GI12294-PA 3..158 4..160 301 41.4 Plus
Dmoj\GI17049-PA 214 GI17049-PA 13..200 7..179 244 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25846-PA 189 GL25846-PA 1..189 1..190 730 71.1 Plus
Dper\GL12881-PA 197 GL12881-PA 12..196 9..190 301 35.5 Plus
Dper\GL21045-PA 175 GL21045-PA 3..172 22..189 293 39.8 Plus
Dper\GL18648-PA 202 GL18648-PA 12..202 6..190 267 36.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25469-PA 189 GA25469-PA 1..189 1..190 730 71.1 Plus
Dpse\GA22616-PA 177 GA22616-PA 1..142 1..142 442 57 Plus
Dpse\GA14144-PA 197 GA14144-PA 12..196 9..190 301 35.5 Plus
Dpse\GA29046-PA 176 GA29046-PA 3..174 22..190 284 38.2 Plus
Dpse\GA25738-PA 202 GA25738-PA 12..202 6..190 267 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18835-PA 190 GM18835-PA 1..190 1..190 923 92.6 Plus
Dsec\GM24886-PA 191 GM24886-PA 1..190 1..190 382 42.6 Plus
Dsec\GM22678-PA 186 GM22678-PA 1..185 1..190 365 42.1 Plus
Dsec\GM12727-PA 200 GM12727-PA 7..199 4..190 296 33.5 Plus
Dsec\GM16621-PA 203 GM16621-PA 13..194 7..183 235 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16333-PA 190 GD16333-PA 1..190 1..190 932 93.7 Plus
Dsim\GD15540-PA 186 GD15540-PA 1..185 1..190 372 43.2 Plus
Dsim\GD21775-PA 188 GD21775-PA 1..187 1..190 370 42.6 Plus
Dsim\GD16332-PA 200 GD16332-PA 7..199 4..190 296 33.5 Plus
Dsim\GD23493-PA 203 GD23493-PA 13..194 7..183 241 32.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19395-PA 191 GJ19395-PA 1..190 1..190 740 72.1 Plus
Dvir\GJ13231-PA 192 GJ13231-PA 6..192 5..190 347 40.2 Plus
Dvir\GJ19394-PA 197 GJ19394-PA 7..196 4..190 309 33 Plus
Dvir\GJ10100-PA 220 GJ10100-PA 13..207 7..180 218 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10152-PA 192 GK10152-PA 1..190 1..190 753 73.7 Plus
Dwil\GK14574-PA 195 GK14574-PA 1..195 1..190 364 42.6 Plus
Dwil\GK10151-PA 199 GK10151-PA 8..198 3..190 313 35.9 Plus
Dwil\GK23972-PA 205 GK23972-PA 14..198 8..187 286 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16896-PA 190 GE16896-PA 1..190 1..190 889 88.4 Plus
Dyak\GE15354-PA 190 GE15354-PA 1..188 1..188 418 44.7 Plus
Dyak\GE16895-PA 200 GE16895-PA 7..199 4..190 296 33.5 Plus
Dyak\GE14641-PA 203 GE14641-PA 13..194 7..183 266 34.8 Plus

IP07779.hyp Sequence

Translation from 147 to 719

> IP07779.hyp
MLVMDALFNSLLVVSSGYAIYTLHPMETPYGYATAALSLVHGILGMVRAA
SNDDDECNRVRLITSGIMEIVPLPLTNMELYLKSTNPGLALAHTCFVVPL
VYDMLAKVVDTEDTVTETLKELTLLGNVVSMLFLGVNESNNMYGILAAIA
FGARYGSAFLDYYWKGLGAEFTLLAHSMFVLLMTMTLSAK*

IP07779.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14269-PB 190 CG14269-PB 1..190 1..190 960 100 Plus
CG14269-PA 190 CG14269-PA 1..190 1..190 960 100 Plus
CG12679-PA 190 CG12679-PA 1..188 1..188 395 42.6 Plus
CG16782-PA 200 CG16782-PA 7..199 4..190 290 32.5 Plus
CG14537-PA 203 CG14537-PA 13..194 7..183 238 32.6 Plus