Clone IP07781 Report

Search the DGRC for IP07781

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:81
Vector:pOT2
Associated Gene/TranscriptCG14315-RA
Protein status:IP07781.pep: gold
Preliminary Size:654
Sequenced Size:789

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14315 2005-01-01 Successful iPCR screen
CG14315 2008-04-29 Release 5.5 accounting
CG14315 2008-08-15 Release 5.9 accounting
CG14315 2008-12-18 5.12 accounting

Clone Sequence Records

IP07781.complete Sequence

789 bp (789 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022599

> IP07781.complete
AAACATAGTACACCTGTCGCACAGACTTATTGTAGTTAGTTTTGTCAAGC
GTTCGAAGCGACTGCAGAAATGAGGGTCTACTTGTATCAAATGCGCCCGG
TGCTCTTTCTCTTCTACATGGTGGAGACGACGGCCAACTTATTCGTTTTG
TACTACCAACTGAAAGCATTTGTTTTCGTCAATCTGACAACGATGAAATG
GGAAGATGTTCTAATCCAAAGCTTTTATATGTCCTTCTTTTACATATTCA
CAGTGGTAACGCTCTTTGCCAGCATAAATCTCTGCACCGGTCATCGCACA
TCGATCGTTGAGGAAGTTGTGCGTCCTCTGATCGGATTTGTTCTATATAC
GGTAATATCGTTGATGGCACTGGGCGATGCCGAGACGGATTTCTATATAT
GGTATGATGGAAGGAACCCGGATGATTTACTATATCCGGAGAAGCCGCTC
CATCCGTTCTTCGGTAGCCTGCGGGACCAGGCGACAGCCTCATTGGTGTC
CAGTGTTATCTATCTGCTGCACTGCCTCATTGCGTTGGATGTCCTTCTGT
CGAATGACGATTCGGATAACGAACGCGAGTCATCCAATTCCTCCGACGAT
GTGAACGAAGAGGTCGACTACGTTCCAGTGCGTCTGTACGTCTTTGGCGG
CGTGATGCAACGCTGGCTGGAGCAGTTCGACTGGTTTCAGGACTTTACCC
ACAGTGGAGTCACAGATATCTGATATTTTATCATTAACTTCATTTATACA
ACTACAAATTACATGATAAACAAAAAAAAAAAAAAAAAA

IP07781.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14315-RA 767 CG14315-RA 1..767 1..767 3835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13983067..13983837 1..771 3855 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18158701..18159475 1..775 3875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17899532..17900306 1..775 3875 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:56:23 has no hits.

IP07781.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:57:16 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13983067..13983837 1..771 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:40 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:07 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:57 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:38 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:52:03 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:02 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:07 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:57 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:38 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..654 70..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:52:03 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
CG14315-RA 1..771 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:16 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18158701..18159471 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:16 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18158701..18159471 1..771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:16 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18158701..18159471 1..771 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:57 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13984423..13985193 1..771 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:05 Download gff for IP07781.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17899532..17900302 1..771 100   Plus

IP07781.pep Sequence

Translation from 69 to 722

> IP07781.pep
MRVYLYQMRPVLFLFYMVETTANLFVLYYQLKAFVFVNLTTMKWEDVLIQ
SFYMSFFYIFTVVTLFASINLCTGHRTSIVEEVVRPLIGFVLYTVISLMA
LGDAETDFYIWYDGRNPDDLLYPEKPLHPFFGSLRDQATASLVSSVIYLL
HCLIALDVLLSNDDSDNERESSNSSDDVNEEVDYVPVRLYVFGGVMQRWL
EQFDWFQDFTHSGVTDI*

IP07781.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16758-PA 218 GF16758-PA 1..210 1..209 600 56.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22659-PA 217 GG22659-PA 1..217 1..217 887 80.2 Plus
Dere\GG11769-PA 359 GG11769-PA 157..352 8..210 365 33.8 Plus
Dere\GG11769-PA 359 GG11769-PA 20..140 8..131 158 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15090-PA 207 GH15090-PA 1..207 8..217 422 42.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14315-PA 217 CG14315-PA 1..217 1..217 1137 100 Plus
CG34433-PA 233 CG34433-PA 31..230 8..214 377 34.6 Plus
CG34433-PB 212 CG34433-PB 31..209 8..214 295 29.4 Plus
CG34432-PA 213 CG34432-PA 20..213 8..217 220 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23715-PA 204 GI23715-PA 1..204 8..217 417 43.8 Plus
Dmoj\GI22116-PA 223 GI22116-PA 22..223 8..217 368 37 Plus
Dmoj\GI23716-PA 203 GI23716-PA 1..199 8..214 297 34 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12590-PA 207 GL12590-PA 2..203 8..213 482 45.1 Plus
Dper\GL12591-PA 211 GL12591-PA 1..211 8..217 469 46.5 Plus
Dper\GL13511-PA 163 GL13511-PA 15..162 8..152 275 35.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27567-PA 207 GA27567-PA 2..203 8..213 477 44.7 Plus
Dpse\GA12902-PA 211 GA12902-PA 1..211 8..217 474 46.5 Plus
Dpse\GA26877-PA 218 GA26877-PA 15..211 8..210 360 34.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15279-PA 217 GM15279-PA 1..217 1..217 1049 90.8 Plus
Dsec\GM12899-PA 381 GM12899-PA 157..331 8..180 310 36.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19203-PA 217 GD19203-PA 1..217 1..217 1053 92.2 Plus
Dsim\GD21538-PA 359 GD21538-PA 157..356 8..214 355 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23274-PA 208 GJ23274-PA 1..204 8..213 458 44.5 Plus
Dvir\GJ24236-PA 221 GJ24236-PA 20..221 8..217 355 34.1 Plus
Dvir\GJ24238-PA 209 GJ24238-PA 8..209 8..217 342 33.6 Plus
Dvir\GJ23275-PA 124 GJ23275-PA 1..119 87..212 256 42.9 Plus
Dvir\GJ24235-PA 109 GJ24235-PA 3..109 103..217 155 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18883-PA 209 GK18883-PA 1..209 8..217 549 48.3 Plus
Dwil\GK14150-PA 228 GK14150-PA 26..228 8..217 429 38.4 Plus
Dwil\GK19182-PA 211 GK19182-PA 5..204 8..210 334 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25513-PA 217 GE25513-PA 1..217 1..217 875 80.6 Plus
Dyak\GE10896-PA 399 GE10896-PA 158..321 8..167 297 37.2 Plus
Dyak\GE10896-PA 399 GE10896-PA 20..151 8..141 164 29 Plus

IP07781.hyp Sequence

Translation from 69 to 722

> IP07781.hyp
MRVYLYQMRPVLFLFYMVETTANLFVLYYQLKAFVFVNLTTMKWEDVLIQ
SFYMSFFYIFTVVTLFASINLCTGHRTSIVEEVVRPLIGFVLYTVISLMA
LGDAETDFYIWYDGRNPDDLLYPEKPLHPFFGSLRDQATASLVSSVIYLL
HCLIALDVLLSNDDSDNERESSNSSDDVNEEVDYVPVRLYVFGGVMQRWL
EQFDWFQDFTHSGVTDI*

IP07781.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14315-PA 217 CG14315-PA 1..217 1..217 1137 100 Plus
CG34433-PA 233 CG34433-PA 31..230 8..214 377 34.6 Plus
CG34433-PB 212 CG34433-PB 31..209 8..214 295 29.4 Plus
CG34432-PA 213 CG34432-PA 20..213 8..217 220 24.9 Plus