Clone IP07785 Report

Search the DGRC for IP07785

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:85
Vector:pOT2
Associated Gene/TranscriptCG14400-RA
Protein status:IP07785.pep: gold
Preliminary Size:702
Sequenced Size:923

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14400 2005-01-01 Successful iPCR screen
CG14400 2008-04-29 Release 5.5 accounting
CG14400 2008-08-15 Release 5.9 accounting
CG14400 2008-12-18 5.12 accounting

Clone Sequence Records

IP07785.complete Sequence

923 bp (923 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022587

> IP07785.complete
ATGATTGCTACGTTGCTTTTAGTATTCCCCCTGCTGTTTATGCCGTCTGA
TGCAACGTTAGGAACGCAGGTGATCAGCTATGACAACAAGCGGATGCTTC
AGCTGATCGAGGACTTTAACGGCACCGTATCCGAGCAGCTCTTCCTGGTG
GTGTCCACGTGGGGAAAACTGAAAGCCGACTACCCTAGAGATGTGGCTAA
GATCGAGGATTTGGAGGAGACTCTGCAGCATGTGGTGTGCCGGAAGGAGA
GAAACGTGACAGTTCGTCATCACCTGCAGGGTTATCTCATCCGCGAACAG
ATCCGCGAGCATCTGGAGACCCTCAACTGCTCTGATCTGTTCCAGCAAGC
ATTGCAATCCGAGGATCATGAGCTGGGCAAGTGGCAGTTGGCTATAGGAC
AGCATTCCCGTAAACTCCACTGTGTGTTTAAGCCAGACCAACTGACAAGG
ATCCTGAAGGCAGTGATTCGTCGGACGTACACCCTGGAGAGATCCACCAG
GCTGGCTGCGCTTCTCTACCAGCTGTATATCGGCAATCGAGAGTCCTATG
CTGCAATGGTCGAAGCCGAGTTGATGCTTTACGAGCGATATAAGAGTGGT
GAAAAAAATAGCCAAGAATTCAGCGGATACATGGCTAAACTCTGGCAAAG
TATCCAAATTGAGGAGTTCTATCCGGGGTTGGATCAAAACACAAAACAAC
GACTTGTTGACGCAATTATAGACCTTCTGAAATTCCTCTAAGTCCAACCC
ATTTATGTGCGAACTTTATTCGGTGATTCGGTTTTGTATATTCGAGTGCT
TTAATACTTTGATTTTAAGTGTGTGTTTCTGTTTGTCTAGCTTCTGAGAT
AATTACATAGGTGAGGGCTTGTGTTCTTTACATTAAAATATCATGTTGTA
CATAGAAAAAAAAAAAAAAAAAA

IP07785.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14400-RA 908 CG14400-RA 1..906 1..906 4530 100 Plus
CG9335-RA 1261 CG9335-RA 1126..1261 906..771 680 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20855518..20856422 905..1 4525 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20856986..20857891 906..1 4530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20856986..20857891 906..1 4530 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:00:29 has no hits.

IP07785.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:01:05 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20855518..20856422 1..905 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:46 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:08 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:50 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:11 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:30 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:32 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..905 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:08 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..905 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:50 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..905 1..905 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:11 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..905 1..905 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:30 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
CG14400-RA 1..905 1..905 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:05 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20856987..20857891 1..905 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:05 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20856987..20857891 1..905 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:05 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20856987..20857891 1..905 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:50 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20856987..20857891 1..905 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:21 Download gff for IP07785.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20856987..20857891 1..905 100   Minus

IP07785.pep Sequence

Translation from 0 to 740

> IP07785.pep
MIATLLLVFPLLFMPSDATLGTQVISYDNKRMLQLIEDFNGTVSEQLFLV
VSTWGKLKADYPRDVAKIEDLEETLQHVVCRKERNVTVRHHLQGYLIREQ
IREHLETLNCSDLFQQALQSEDHELGKWQLAIGQHSRKLHCVFKPDQLTR
ILKAVIRRTYTLERSTRLAALLYQLYIGNRESYAAMVEAELMLYERYKSG
EKNSQEFSGYMAKLWQSIQIEEFYPGLDQNTKQRLVDAIIDLLKFL*

IP07785.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24285-PA 248 GF24285-PA 6..248 5..246 761 59.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21543-PA 246 GG21543-PA 16..246 16..246 967 83.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14400-PA 246 CG14400-PA 1..246 1..246 1259 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19587-PA 80 GL19587-PA 1..80 168..246 249 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12955-PA 323 GA12955-PA 95..323 19..246 822 65.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23299-PA 246 GM23299-PA 1..246 1..246 1235 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21671-PA 246 GD21671-PA 1..246 1..246 1244 94.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19025-PA 246 GK19025-PA 5..246 7..246 672 53.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13018-PA 246 GE13018-PA 13..246 13..246 1104 88.5 Plus

IP07785.hyp Sequence

Translation from 1 to 740

> IP07785.hyp
MIATLLLVFPLLFMPSDATLGTQVISYDNKRMLQLIEDFNGTVSEQLFLV
VSTWGKLKADYPRDVAKIEDLEETLQHVVCRKERNVTVRHHLQGYLIREQ
IREHLETLNCSDLFQQALQSEDHELGKWQLAIGQHSRKLHCVFKPDQLTR
ILKAVIRRTYTLERSTRLAALLYQLYIGNRESYAAMVEAELMLYERYKSG
EKNSQEFSGYMAKLWQSIQIEEFYPGLDQNTKQRLVDAIIDLLKFL*

IP07785.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14400-PA 246 CG14400-PA 1..246 1..246 1259 100 Plus