Clone IP07787 Report

Search the DGRC for IP07787

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:87
Vector:pOT2
Associated Gene/TranscriptCG14463-RA
Protein status:IP07787.pep: gold
Preliminary Size:666
Sequenced Size:924

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14463 2005-01-01 Successful iPCR screen
CG14463 2008-04-29 Release 5.5 accounting
CG14463 2008-08-15 Release 5.9 accounting
CG14463 2008-12-18 5.12 accounting

Clone Sequence Records

IP07787.complete Sequence

924 bp (924 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022579

> IP07787.complete
AGATGCAAGTCCTCTTTGTAATGATATAAAGAAATATAAAATTATAGACG
GACTTAATACATTCACTGTTATCTGTGCTGATAACTGTTCCATTTGAATT
TAGTGGCAAACCACCACAACTGTTTGACCACTTGAGACTAACCCGTTTCA
CCATCTGGTAACACCTGGTCGAGGAATGGAGCCCAAAGTGACGATCCACA
GATATTATAGCCGGCAAGCGAAATATGAAGGAGCCGTGGAAGCGGACTTG
GAACTGTGCATCAAGCACTGCGGCGGCGACGTGGTTCGCATCGAACTGGT
GAACCGGCTGCATGGAATCCAACTGCAGCGCAAGTTGCGTCGACTACTGC
TGCTCATGTTCCTATCTATCGCTTATTTTGTGGGGACCTGCGGGTTTGAT
AACAGAACGATTAGTTTCCTGCAGCCCCGTATTCTGTACCCACTGATAAC
GTGTGCTTCCGTGGCCATCCTGCTCATCCGATCCACTCTGAACCTGGTGC
AGGCTGAGCGGTTGTTCTACAGCTGGGACATGGCACTCCAAATGGAGACG
GTGCGCTCCTTTGGCAGGGAATCGGTCCTCTGCGTCCAAAGGGGACACAT
CGAGGACATAGTGCTAAACGAAGTTATTGAAGACTTGGACGTAAAGTACA
TGCTTATATTACGTACAAAAGGAAGTCAATTCAAGAAGCGCCCTATAATA
CCCCTATTCAATAGTCAATCCCCCTCAATTGAGTGTCTGCAGCACACATA
TCACGTGCTGCATAAATATTGGCTGAACAGCACCAAAGACCGGTCAGAAG
AGTCCTACAGCAAGGACAAGCAGTCCTTAGTGAATTCGTAGTCCTTGGCC
ATATCGCTGAACTGTTAAAGTATTTATTAGAGACTTAATAACATTTAGAC
AAACTTAAAAAAAAAAAAAAAAAA

IP07787.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14463-RA 1122 CG14463-RA 47..953 1..907 4535 100 Plus
CG42550.a 653 CG42550.a 287..436 862..713 750 100 Minus
CG42550-RA 659 CG42550-RA 290..442 865..713 750 99.3 Minus
CG42550.a 653 CG42550.a 497..574 712..635 390 100 Minus
CG42550-RA 659 CG42550-RA 503..580 712..635 390 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3825913..3826546 1..634 3170 100 Plus
chr3R 27901430 chr3R 3826767..3826960 713..906 970 100 Plus
chr3R 27901430 chr3R 3826629..3826706 635..712 390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7999870..8000503 1..634 3170 100 Plus
3R 32079331 3R 8000724..8000918 713..907 975 100 Plus
3R 32079331 3R 8000586..8000663 635..712 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7740701..7741334 1..634 3170 100 Plus
3R 31820162 3R 7741555..7741749 713..907 975 100 Plus
3R 31820162 3R 7741417..7741494 635..712 390 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:44:32 has no hits.

IP07787.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:45:30 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3825913..3826546 1..634 100 -> Plus
chr3R 3826629..3826706 635..712 100 -> Plus
chr3R 3826767..3826960 713..906 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:49 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..666 176..841 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:08 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..666 176..841 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:25:01 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..666 176..841 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:39 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..666 176..841 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:48:37 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..666 176..841 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:04 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:08 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:25:01 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RB 39..944 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:39 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:48:37 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
CG14463-RB 39..944 1..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:30 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7999870..8000503 1..634 100 -> Plus
3R 8000586..8000663 635..712 100 -> Plus
3R 8000724..8000917 713..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:30 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7999870..8000503 1..634 100 -> Plus
3R 8000586..8000663 635..712 100 -> Plus
3R 8000724..8000917 713..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:45:30 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7999870..8000503 1..634 100 -> Plus
3R 8000586..8000663 635..712 100 -> Plus
3R 8000724..8000917 713..906 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:25:01 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3825592..3826225 1..634 100 -> Plus
arm_3R 3826308..3826385 635..712 100 -> Plus
arm_3R 3826446..3826639 713..906 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:07 Download gff for IP07787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7740701..7741334 1..634 100 -> Plus
3R 7741417..7741494 635..712 100 -> Plus
3R 7741555..7741748 713..906 100   Plus

IP07787.pep Sequence

Translation from 175 to 840

> IP07787.pep
MEPKVTIHRYYSRQAKYEGAVEADLELCIKHCGGDVVRIELVNRLHGIQL
QRKLRRLLLLMFLSIAYFVGTCGFDNRTISFLQPRILYPLITCASVAILL
IRSTLNLVQAERLFYSWDMALQMETVRSFGRESVLCVQRGHIEDIVLNEV
IEDLDVKYMLILRTKGSQFKKRPIIPLFNSQSPSIECLQHTYHVLHKYWL
NSTKDRSEESYSKDKQSLVNS*

IP07787.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18151-PA 207 GF18151-PA 1..205 1..205 785 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14319-PA 221 GG14319-PA 1..221 1..221 1056 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14050-PA 219 GH14050-PA 1..219 1..221 646 56.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
PIG-H-PB 221 CG14463-PB 1..221 1..221 1138 100 Plus
PIG-H-PA 221 CG14463-PA 1..221 1..221 1138 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24425-PA 219 GI24425-PA 1..219 1..221 637 56.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24453-PA 228 GL24453-PA 1..214 1..215 748 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13004-PA 228 GA13004-PA 1..214 1..215 743 67.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10991-PA 221 GM10991-PA 1..221 1..221 1161 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19961-PA 221 GD19961-PA 1..221 1..221 1154 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14283-PA 219 GJ14283-PA 1..219 1..221 642 55.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13067-PA 224 GK13067-PA 1..224 1..221 555 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24958-PA 221 GE24958-PA 1..221 1..221 1031 86.9 Plus
Dyak\GE11165-PA 221 GE11165-PA 1..221 1..221 1023 86.4 Plus

IP07787.hyp Sequence

Translation from 175 to 840

> IP07787.hyp
MEPKVTIHRYYSRQAKYEGAVEADLELCIKHCGGDVVRIELVNRLHGIQL
QRKLRRLLLLMFLSIAYFVGTCGFDNRTISFLQPRILYPLITCASVAILL
IRSTLNLVQAERLFYSWDMALQMETVRSFGRESVLCVQRGHIEDIVLNEV
IEDLDVKYMLILRTKGSQFKKRPIIPLFNSQSPSIECLQHTYHVLHKYWL
NSTKDRSEESYSKDKQSLVNS*

IP07787.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14463-PB 221 CG14463-PB 1..221 1..221 1138 100 Plus
CG14463-PA 221 CG14463-PA 1..221 1..221 1138 100 Plus