Clone IP07793 Report

Search the DGRC for IP07793

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:77
Well:93
Vector:pOT2
Associated Gene/TranscriptCG14676-RA
Protein status:IP07793.pep: gold
Preliminary Size:735
Sequenced Size:986

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14676 2005-01-01 Successful iPCR screen
CG14676 2008-04-29 Release 5.5 accounting
CG14676 2008-08-15 Release 5.9 accounting
CG14676 2008-12-18 5.12 accounting

Clone Sequence Records

IP07793.complete Sequence

986 bp (986 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022571

> IP07793.complete
CAGTACCTTTACATAGGCTAACACTGTAATTGAGTTTTACGGAAACACAA
AAAAAAACATAAAAATATATTTTCCGCAATGGCTGAAAAAACACAAGACG
CCATGCTGGCCGAAATGGATTTGATCTTTCTGGACCACATACTGCCGAGG
TGCTGCAAGGACATCACCACCTCGCAAGCGTTCTACAAGGACTACACCGC
CGACAAGCCGAAGCGAACAGTCACCGCGTTCCGGAAGCAAACGGATCCCG
CCCTGATCTCGGGCCACTATGCGCACAACTTGAAGGTCCAGAAGCAGGAG
TTGAAGACGCGGACATGGCCACGATCCATGGACTGGCGCGAGGAGTACGC
GCAGTTCGTCAAGCGCAACAAGTGGTGCAACGAGGAGATCTACAAGCTCT
TCTTCGTGAACCCGCCCGTCGACTACTTCCTCATCAGGGAATATCTGCAG
GACCTGCTGAAAACCACCTATATGTCGGACTACTCGCCCAAAGACTACCA
GTCGCTCATCAGCCAGCGCGAGCATAGGGTCCAACTCGACGGCTCGGACG
GCATTGACTATCGGACGACCTATGGCAACTATCACAATCGTATCCAGGAG
GAGGATCCGTTCAAGTCGATCCTCATCCCAGAACCAGGATCGATTGTCAG
GAGCATGGAGATAGGAGAGTTCGCCAAGCAGATGCGCAAGCTGTTCACTA
AGTACAATCTAACCACCTACTACGAGACCATCTGCCTTCCGGCGCTGATA
AAGGCCAAGGATGGTATTATGCCATCGGGGCCGATCGATCGCTACACACT
TCGCAAGCACTGAATCGCACCCAAGTCGAGTTAACCAGGTCACGATTACT
CCAGCTACTGCATGCAGTTGGATTTATTTATTAATAGTTATTATTGTACT
AAATATACATTCGGCGCCTACTATGATACGAAGTACCACAAAAGGTACCG
TAAAAAGGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP07793.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14676-RA 958 CG14676-RA 1..958 1..958 4790 100 Plus
CG34287-RA 951 CG34287-RA 274..360 312..398 270 87.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1672866..1673823 1..958 4790 100 Plus
chr3R 27901430 chr3R 1679251..1679337 312..398 270 87.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5847220..5848178 1..959 4795 100 Plus
3R 32079331 3R 5853605..5853691 312..398 270 87.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5588051..5589009 1..959 4795 100 Plus
3R 31820162 3R 5594436..5594522 312..398 270 87.3 Plus
Blast to na_te.dros performed 2019-03-15 20:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 1455..1501 49..95 109 70.2 Plus

IP07793.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:14 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1672866..1673823 1..958 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:52 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..735 79..813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:09 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..735 79..813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:52 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..735 79..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:40 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..735 79..813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:06 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..735 79..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:09 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..958 1..958 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:09 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..958 1..958 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:52 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..958 1..958 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:40 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..958 1..958 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:06 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
CG14676-RA 1..958 1..958 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:14 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5847220..5848177 1..958 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:14 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5847220..5848177 1..958 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:14 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5847220..5848177 1..958 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:52 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1672942..1673899 1..958 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:08 Download gff for IP07793.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5588051..5589008 1..958 100   Plus

IP07793.pep Sequence

Translation from 78 to 812

> IP07793.pep
MAEKTQDAMLAEMDLIFLDHILPRCCKDITTSQAFYKDYTADKPKRTVTA
FRKQTDPALISGHYAHNLKVQKQELKTRTWPRSMDWREEYAQFVKRNKWC
NEEIYKLFFVNPPVDYFLIREYLQDLLKTTYMSDYSPKDYQSLISQREHR
VQLDGSDGIDYRTTYGNYHNRIQEEDPFKSILIPEPGSIVRSMEIGEFAK
QMRKLFTKYNLTTYYETICLPALIKAKDGIMPSGPIDRYTLRKH*

IP07793.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16363-PA 246 GF16363-PA 4..246 3..244 877 69.5 Plus
Dana\GF16366-PA 241 GF16366-PA 9..241 11..244 612 52.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13088-PA 243 GG13088-PA 1..243 1..244 1203 91 Plus
Dere\GG13094-PA 235 GG13094-PA 2..235 7..244 594 50.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16277-PA 248 GH16277-PA 4..248 1..244 603 49.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14676-PA 244 CG14676-PA 1..244 1..244 1307 100 Plus
CG34287-PA 235 CG34287-PA 2..235 7..244 619 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22185-PA 205 GI22185-PA 13..205 51..244 575 58.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24039-PA 245 GL24039-PA 1..245 1..244 758 60.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13168-PA 245 GA13168-PA 1..245 1..244 752 60.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10849-PA 180 GM10849-PA 1..164 1..164 872 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19831-PA 244 GD19831-PA 1..244 1..244 1299 98 Plus
Dsim\GD19833-PA 235 GD19833-PA 2..235 7..244 616 51.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24304-PA 246 GJ24304-PA 14..246 10..244 611 51 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18939-PA 241 GK18939-PA 13..241 17..244 662 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10175-PA 243 GE10175-PA 1..243 1..244 1192 90.2 Plus

IP07793.hyp Sequence

Translation from 78 to 812

> IP07793.hyp
MAEKTQDAMLAEMDLIFLDHILPRCCKDITTSQAFYKDYTADKPKRTVTA
FRKQTDPALISGHYAHNLKVQKQELKTRTWPRSMDWREEYAQFVKRNKWC
NEEIYKLFFVNPPVDYFLIREYLQDLLKTTYMSDYSPKDYQSLISQREHR
VQLDGSDGIDYRTTYGNYHNRIQEEDPFKSILIPEPGSIVRSMEIGEFAK
QMRKLFTKYNLTTYYETICLPALIKAKDGIMPSGPIDRYTLRKH*

IP07793.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14676-PA 244 CG14676-PA 1..244 1..244 1307 100 Plus
CG34287-PA 235 CG34287-PA 2..235 7..244 619 50.6 Plus