Clone IP07829 Report

Search the DGRC for IP07829

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:78
Well:29
Vector:pOT2
Associated Gene/TranscriptCG12438-RA
Protein status:IP07829.pep: gold
Preliminary Size:726
Sequenced Size:897

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12438 2005-01-01 Successful iPCR screen
CG12438 2008-04-29 Release 5.5 accounting
CG12438 2008-08-15 Release 5.9 accounting
CG12438 2008-12-18 5.12 accounting

Clone Sequence Records

IP07829.complete Sequence

897 bp (897 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022563

> IP07829.complete
ATTTTAGTAATCTTTTTTATAATTATGTACCAAATTTCTACATGCAAGTC
CTTGGGTTTGTTGATCGAAAATGGCGAGCAATGAGAACGAGAATGGCATA
GCGCTGGTCAAGTTTGTAACATGGACCCTGCTCATTTTGGGCATCTGTTT
GCTGGCCGCCATTCCGCAATGGATGATCCTGTGTCTGTTTGGAGATGATG
CCCTCATATACACCATCGCCTGCTTTTTCGTGGGCTTCGTGCTGCTCGTC
TGCATCCATTTGATTGAGCCGCTGAAGTACTGGAGGCCCTGGAACTATAT
CGTCATCGCCGTTTGCTACGAATTTATGACACTCGGGGCAGGAAGTTTTC
TAATGAACTGGCGTCTGGTTTGCTCCATTGTGACGATGGCCACGGCACTG
CTTTTCCTCGGTATCACGCTGCTCATTTGTGCCGTTCTAATTAGCACTGG
ATTTTATATGAACCCCTTCAAACTGGCCGTTGTGGGAGGAATGCTATTCG
TTCTGGCATTCTGTATTGAACTTATGAATATCCTGCTAGCGTGGAGGTAT
TGGCAGGATGTGGCTATCGGTGTCTTCCTTGTCAGTGTAGTTATTTTGGT
CATCTCCCACGTGTTGATCACCTACATCAGCTTCGAGTACCTGGTCAGAG
ATGACACCATCTTGGTCGCCATAGTGCTCTATATCGCCTATATACTCTTC
CTGATCGGCAGTCGCATTTCCATCATATATATCAAGGGAAACGCCGATCA
CTCCGCTACAGCGACCACTTCAACCCCCTATGACGAATATGACTAATATC
GTAAAAGTTTTTGATGTATCCTCTGTGTAAGCTAAAATGTCTGATTTTCT
AATAATTAAATCTCATGCACTCTTTTTAATAAAAAAAAAAAAAAAAA

IP07829.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12438-RA 877 CG12438-RA 1..877 1..877 4385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8751218..8752097 1..880 4265 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8752330..8753211 1..882 4410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8752330..8753211 1..882 4410 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:20:42 has no hits.

IP07829.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:21:22 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8751218..8752097 1..880 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:55 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:11 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:15:54 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:41 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:52 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:11 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:10 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 26..905 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:15:54 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 46..925 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:41 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 1..726 71..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:52 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
CG12438-RA 46..925 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:21:22 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8752330..8753209 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:21:22 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8752330..8753209 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:21:22 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8752330..8753209 1..880 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:15:54 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8752330..8753209 1..880 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:09 Download gff for IP07829.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8752330..8753209 1..880 100   Plus

IP07829.pep Sequence

Translation from 70 to 795

> IP07829.pep
MASNENENGIALVKFVTWTLLILGICLLAAIPQWMILCLFGDDALIYTIA
CFFVGFVLLVCIHLIEPLKYWRPWNYIVIAVCYEFMTLGAGSFLMNWRLV
CSIVTMATALLFLGITLLICAVLISTGFYMNPFKLAVVGGMLFVLAFCIE
LMNILLAWRYWQDVAIGVFLVSVVILVISHVLITYISFEYLVRDDTILVA
IVLYIAYILFLIGSRISIIYIKGNADHSATATTSTPYDEYD*

IP07829.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15543-PA 227 GF15543-PA 3..226 5..228 569 53.1 Plus
Dana\GF15542-PA 232 GF15542-PA 5..227 4..226 481 43.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25302-PA 247 GG25302-PA 1..233 1..235 790 71.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12438-PA 241 CG12438-PA 1..241 1..241 1247 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17414-PA 238 GI17414-PA 1..214 1..213 243 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25563-PA 256 GL25563-PA 14..207 15..207 266 36.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11634-PA 256 GA11634-PA 14..207 15..207 275 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17129-PA 241 GM17129-PA 1..241 1..241 1057 89.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23561-PA 241 GD23561-PA 1..241 1..241 1063 90 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18349-PA 243 GJ18349-PA 10..241 10..236 303 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18792-PA 238 GE18792-PA 1..227 1..227 805 70 Plus

IP07829.hyp Sequence

Translation from 70 to 795

> IP07829.hyp
MASNENENGIALVKFVTWTLLILGICLLAAIPQWMILCLFGDDALIYTIA
CFFVGFVLLVCIHLIEPLKYWRPWNYIVIAVCYEFMTLGAGSFLMNWRLV
CSIVTMATALLFLGITLLICAVLISTGFYMNPFKLAVVGGMLFVLAFCIE
LMNILLAWRYWQDVAIGVFLVSVVILVISHVLITYISFEYLVRDDTILVA
IVLYIAYILFLIGSRISIIYIKGNADHSATATTSTPYDEYD*

IP07829.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12438-PA 241 CG12438-PA 1..241 1..241 1247 100 Plus