Clone IP07844 Report

Search the DGRC for IP07844

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:78
Well:44
Vector:pOT2
Associated Gene/TranscriptCG13078-RA
Protein status:IP07844.pep: gold
Preliminary Size:669
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13078 2005-01-01 Successful iPCR screen
CG13078 2008-04-29 Release 5.5 accounting
CG13078 2008-08-15 Release 5.9 accounting
CG13078 2008-12-18 5.12 accounting

Clone Sequence Records

IP07844.complete Sequence

926 bp (926 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022559

> IP07844.complete
ATTGTGAAGGCAATAAAAACCTCAGTTGCGCATAGTGGCTTGTAATAGCT
AATGCACGGCGGATCGATAGTCGAAAAAGCAACGCCACAATGAGCGATGA
CAAAACAAAACCAACCTCAGTGCTCCAGCATATAGAATCGGCGCTATATG
TGATCAACCAGCTGTGCATAGGATTCGTCACCATTTGGATCAGCTGGACC
TGCTTGCGCCAGGACCTCTCGGGCATTCGCCTGCATGCCTGGCTGGTTAC
CTTCGGTTTTGTGTTCCTGATGGCCGAGGGAATGATGTGCTTCTACGACG
GCAGTTGGCTAACTGTGCGTTACTCCCGGAATTACAAGACTGCCTTTCAC
GTGGTCCTTCAGATCCTTGGGGGAGGCATGGGCGTGGCCGGCTGTTTGAT
TCAACTAATACGTGACGATTGGTCAATCAGCGTCACGTTACATGCCCGCC
TGGGTTTCGCCGCCTTCGTCCTGTGTCTGATCTCATTGCTGAGTGGACTG
GTCGCCTTCCTGGCGAGATGCCTGAGCAGGACCATCTCACCCTTGGTCAA
CAAGACCTTCCATGTGGTCCTCAGCTTCACCGCCTTCGTGATCGCCATGA
TGGCGCAGTTTTACGGATACACACAGACTGGAATTTTCAGGGGACAAGGA
CAGGATTTCGTTGTCCTCATGCAGGTCGTCACTATGGTCCTAATGGTCCT
AACCAGCATTGGCGCCATTAAGTCGCTCTACCAGAAGATTGGTAGCCTGG
CCAGTTAGGAACGCCTGTCGATTATCCCTAATCCTGTATATCTATAGTGC
ACTTAAGCTAAGCTAGACTATTTGCTATTTATATATTAAACTAATGTTAT
CATAAGGATAAATCAAATGACTAAGAAAAAAATAAAAAATGACTACGACT
TATTTACATTAAAAAAAAAAAAAAAA

IP07844.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13078.a 910 CG13078.a 1..910 1..910 4550 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19562864..19563698 76..910 4145 99.8 Plus
chr2L 23010047 chr2L 19562470..19562548 1..79 395 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19564324..19565162 76..914 4195 100 Plus
2L 23513712 2L 19563930..19564008 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19564324..19565162 76..914 4195 100 Plus
2L 23513712 2L 19563930..19564008 1..79 395 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:50:19 has no hits.

IP07844.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:51:05 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19562470..19562548 1..79 100 -> Plus
chr2L 19562868..19563698 80..910 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:33:56 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:13 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:43 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:43 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:34 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:15 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:13 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:43 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..910 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:44 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..669 90..758 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:34 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
CG13078-RA 1..910 1..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:51:05 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19563930..19564008 1..79 100 -> Plus
2L 19564328..19565158 80..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:51:05 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19563930..19564008 1..79 100 -> Plus
2L 19564328..19565158 80..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:51:05 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19563930..19564008 1..79 100 -> Plus
2L 19564328..19565158 80..910 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:43 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19563930..19564008 1..79 100 -> Plus
arm_2L 19564328..19565158 80..910 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:12 Download gff for IP07844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19564328..19565158 80..910 100   Plus
2L 19563930..19564008 1..79 100 -> Plus

IP07844.pep Sequence

Translation from 89 to 757

> IP07844.pep
MSDDKTKPTSVLQHIESALYVINQLCIGFVTIWISWTCLRQDLSGIRLHA
WLVTFGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAFHVVLQILGGGMGVA
GCLIQLIRDDWSISVTLHARLGFAAFVLCLISLLSGLVAFLARCLSRTIS
PLVNKTFHVVLSFTAFVIAMMAQFYGYTQTGIFRGQGQDFVVLMQVVTMV
LMVLTSIGAIKSLYQKIGSLAS*

IP07844.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14250-PA 222 GF14250-PA 1..222 1..222 1050 88.7 Plus
Dana\GF14251-PA 269 GF14251-PA 58..266 12..221 472 49.3 Plus
Dana\GF15625-PA 229 GF15625-PA 1..216 1..217 185 28.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21199-PA 222 GG21199-PA 1..222 1..222 1087 93.2 Plus
Dere\GG21200-PA 269 GG21200-PA 58..261 12..216 469 51 Plus
Dere\GG21623-PA 228 GG21623-PA 1..216 1..217 176 28.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13426-PA 222 GH13426-PA 1..216 1..216 852 73.1 Plus
Dgri\GH13959-PA 226 GH13959-PA 5..224 2..222 435 44.1 Plus
Dgri\GH13958-PA 226 GH13958-PA 9..224 3..222 424 46.2 Plus
Dgri\GH13427-PA 279 GH13427-PA 62..277 3..222 422 45.7 Plus
Dgri\GH13501-PA 230 GH13501-PA 1..220 1..217 207 29.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13078-PA 222 CG13078-PA 1..222 1..222 1139 100 Plus
CG13077-PB 226 CG13077-PB 15..223 12..221 521 50.2 Plus
CG13077-PA 269 CG13077-PA 58..266 12..221 521 50.2 Plus
CG10165-PD 228 CG10165-PD 1..216 1..217 198 28.4 Plus
CG10165-PC 228 CG10165-PC 1..216 1..217 198 28.4 Plus
CG10165-PE 228 CG10165-PE 1..216 1..217 198 28.4 Plus
CG10165-PB 228 CG10165-PB 1..216 1..217 198 28.4 Plus
CG10165-PA 228 CG10165-PA 1..216 1..217 198 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13934-PA 222 GI13934-PA 1..222 1..222 888 76.1 Plus
Dmoj\GI13943-PA 288 GI13943-PA 77..285 12..221 469 48.8 Plus
Dmoj\GI10191-PA 228 GI10191-PA 15..220 12..217 185 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25553-PA 222 GL25553-PA 1..222 1..222 922 75.2 Plus
Dper\GL25554-PA 226 GL25554-PA 1..223 1..221 500 47.1 Plus
Dper\GL25680-PA 228 GL25680-PA 1..216 1..217 199 28.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12028-PA 222 GA12028-PA 1..222 1..222 919 74.8 Plus
Dpse\GA12027-PA 226 GA12027-PA 1..223 1..221 500 47.1 Plus
Dpse\GA10125-PA 228 GA10125-PA 1..216 1..217 201 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17369-PA 126 GM17369-PA 1..126 97..222 621 96.8 Plus
Dsec\GM17371-PA 269 GM17371-PA 58..266 12..221 512 49.8 Plus
Dsec\GM17368-PA 72 GM17368-PA 1..72 1..72 378 94.4 Plus
Dsec\GM17001-PA 228 GM17001-PA 1..216 1..217 185 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24226-PA 222 GD24226-PA 1..222 1..222 1130 97.7 Plus
Dsim\GD24227-PA 269 GD24227-PA 56..266 10..221 472 49.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18230-PA 224 GJ18230-PA 7..224 5..222 821 73.4 Plus
Dvir\GJ18231-PA 280 GJ18231-PA 62..277 5..221 464 48.2 Plus
Dvir\GJ18011-PA 229 GJ18011-PA 17..219 15..217 195 29.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14917-PA 222 GK14917-PA 2..222 1..222 881 73 Plus
Dwil\GK14918-PA 283 GK14918-PA 63..280 4..221 456 46.4 Plus
Dwil\GK23711-PA 229 GK23711-PA 1..212 1..213 178 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13272-PA 222 GE13272-PA 1..222 1..222 1114 95.5 Plus
Dyak\GE13274-PA 269 GE13274-PA 58..267 12..222 469 50 Plus
Dyak\GE12642-PA 228 GE12642-PA 1..216 1..217 184 28.4 Plus

IP07844.hyp Sequence

Translation from 89 to 757

> IP07844.hyp
MSDDKTKPTSVLQHIESALYVINQLCIGFVTIWISWTCLRQDLSGIRLHA
WLVTFGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAFHVVLQILGGGMGVA
GCLIQLIRDDWSISVTLHARLGFAAFVLCLISLLSGLVAFLARCLSRTIS
PLVNKTFHVVLSFTAFVIAMMAQFYGYTQTGIFRGQGQDFVVLMQVVTMV
LMVLTSIGAIKSLYQKIGSLAS*

IP07844.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13078-PA 222 CG13078-PA 1..222 1..222 1139 100 Plus
CG13077-PB 226 CG13077-PB 15..223 12..221 521 50.2 Plus
CG13077-PA 269 CG13077-PA 58..266 12..221 521 50.2 Plus
CG10165-PD 228 CG10165-PD 1..216 1..217 198 28.4 Plus
CG10165-PC 228 CG10165-PC 1..216 1..217 198 28.4 Plus