Clone IP07882 Report

Search the DGRC for IP07882

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:78
Well:82
Vector:pOT2
Associated Gene/TranscriptCG14331-RC
Protein status:IP07882.pep: gold
Preliminary Size:747
Sequenced Size:1160

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14331 2005-01-01 Successful iPCR screen
CG14331 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP07882.complete Sequence

1160 bp assembled on 2010-08-02

GenBank Submission: BT125070.1

> IP07882.complete
CTTGGTCAAAGTAACATCGTCAGGATGAAGGAAGGAAAATTGGAGCAGAC
GCGCAGTAAACTAGAGCAAATACTTAATATCCATAAGCCAAATTATCTGG
ATAGTACTTTTCAAGAGCTTCTTCCCAATTTTTGCAAAGGATTTCTATTC
AGCGAAAAATGGGTTAAGTGGATCAAAATTGTTTTGCTCGGAACTCTTAT
TTTATTGGGAGTTAAATACTACTATGAAGAAATGCAGGGAAAGAATTGCG
CTCTATATCTGCCTCGCAACTTGCGTTACGCTTTCCGACCGCCTGAAAAT
TGTAATTTCTGTGCAAATATTAAAAATGTGCCGCGACTTAAAAATATTAG
CCCCCAGGAGTTTGAGAAAAAATTCGCATACAGTGCAGCGCCAGTTATCA
TTAGTGATGCCACTAAAAATTGGACAGCAGTTTCGTTATTTAACTACTGG
TATTTTCGCGATGTTTATACCAAGGCCAAGCAAAAGCAGCACATAAGGGA
ATGCCAGTTCCTGCCGTATAAAACCGGATTTTTGGATATCTATGACGCTT
TGGATATGCCCGAGGATCGGGTGGAGCTAAAACCAGGCGAACAGCCCTGG
TACTTCGGCTGGAGCAACTGCCATGCGGAAACCGCAGAGGAATTCCGCAG
GCACTATGGTAGACCATATTTTCTGCCCGAAGGCTCGGAAAACAATGCTG
TTGATTGGTTTTTCATTGGCTTATCCGGCTTGGGTGCCCAAATGCATATT
GACAACGTGAGACTGCCATCGTGGCAGGCTCAGCTGGCGGGCAGCAAGCG
ATGGCTACTGGTTCCACCTCCCGAGTGCTACCTGCAGTGCCGGAGATTCG
ACGTGGTGGTCCAACAGGGCGACATAATTGTGTTGGACACGAACAAGTGG
TACCACCAGACCTTTGTGCAGCCGGGAGCCATCAGCCTGACCATTGGAGC
TGAGTACGACTAGAGTTAACCGGCTGCATGCGGTTTTTCCTCGTGACAGG
AAATGGCTGTCCCAAACATCTCCATTCGGATTCGGACACAAATATGGCCA
ACTGTTACTGTTACAGTAACAAACTTAACTTTAACTTTGCCATATTACTC
TGCTTTTGCCAGCCGGTTTGTTAATTAAACTCCAAAAACAAAAAAAAAAA
AAAAAAAAAA

IP07882.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13264207..13264519 747..435 1550 99.7 Minus
chr3R 27901430 chr3R 13263344..13263605 1139..878 1280 99.2 Minus
chr3R 27901430 chr3R 13264859..13265101 243..1 1155 98.4 Minus
chr3R 27901430 chr3R 13264579..13264772 435..242 940 99 Minus
chr3R 27901430 chr3R 13263668..13263802 877..743 660 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17439836..17440148 747..435 1565 100 Minus
3R 32079331 3R 17438971..17439233 1140..878 1315 100 Minus
3R 32079331 3R 17440486..17440728 243..1 1215 100 Minus
3R 32079331 3R 17440208..17440401 435..242 970 100 Minus
3R 32079331 3R 17439296..17439430 877..743 660 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17180667..17180979 747..435 1565 100 Minus
3R 31820162 3R 17179802..17180064 1140..878 1315 100 Minus
3R 31820162 3R 17181317..17181559 243..1 1215 100 Minus
3R 31820162 3R 17181039..17181232 435..242 970 100 Minus
3R 31820162 3R 17180127..17180261 877..743 660 99.2 Minus
Blast to na_te.dros performed on 2019-03-16 15:28:05 has no hits.

IP07882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:28:53 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13264579..13264770 244..435 98 <- Minus
chr3R 13264859..13265101 1..243 98   Minus
chr3R 13263344..13263605 878..1139 99 <- Minus
chr3R 13263668..13263797 748..877 100 <- Minus
chr3R 13264207..13264518 436..747 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-02 09:57:38 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..939 25..963 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:15 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..939 25..963 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:45:55 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..939 25..963 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:48 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..939 25..963 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-02 09:57:37 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..1134 6..1139 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:14 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..1139 1..1139 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:45:55 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..1139 1..1139 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:48 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
CG14331-RC 1..1139 1..1139 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:53 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17438972..17439233 878..1139 100 <- Minus
3R 17439296..17439425 748..877 100 <- Minus
3R 17439836..17440147 436..747 100 <- Minus
3R 17440208..17440399 244..435 100 <- Minus
3R 17440486..17440728 1..243 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:53 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17438972..17439233 878..1139 100 <- Minus
3R 17439296..17439425 748..877 100 <- Minus
3R 17439836..17440147 436..747 100 <- Minus
3R 17440208..17440399 244..435 100 <- Minus
3R 17440486..17440728 1..243 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:53 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17438972..17439233 878..1139 100 <- Minus
3R 17439296..17439425 748..877 100 <- Minus
3R 17439836..17440147 436..747 100 <- Minus
3R 17440208..17440399 244..435 100 <- Minus
3R 17440486..17440728 1..243 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:45:55 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13264694..13264955 878..1139 100 <- Minus
arm_3R 13265018..13265147 748..877 100 <- Minus
arm_3R 13265558..13265869 436..747 100 <- Minus
arm_3R 13265930..13266121 244..435 100 <- Minus
arm_3R 13266208..13266450 1..243 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:22 Download gff for IP07882.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17180667..17180978 436..747 100 <- Minus
3R 17181039..17181230 244..435 100 <- Minus
3R 17181317..17181559 1..243 100   Minus
3R 17179803..17180064 878..1139 100 <- Minus
3R 17180127..17180256 748..877 100 <- Minus

IP07882.hyp Sequence

Translation from 0 to 962

> IP07882.hyp
LGQSNIVRMKEGKLEQTRSKLEQILNIHKPNYLDSTFQELLPNFCKGFLF
SEKWVKWIKIVLLGTLILLGVKYYYEEMQGKNCALYLPRNLRYAFRPPEN
CNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYW
YFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDRVELKPGEQPW
YFGWSNCHAETAEEFRRHYGRPYFLPEGSENNAVDWFFIGLSGLGAQMHI
DNVRLPSWQAQLAGSKRWLLVPPPECYLQCRRFDVVVQQGDIIVLDTNKW
YHQTFVQPGAISLTIGAEYD*

IP07882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14331-PC 312 CG14331-PC 1..312 9..320 1715 100 Plus
CG2211-PB 330 CG2211-PB 71..329 62..319 397 34 Plus
CG2211-PA 330 CG2211-PA 71..329 62..319 397 34 Plus

IP07882.pep Sequence

Translation from 0 to 962

> IP07882.pep
LGQSNIVRMKEGKLEQTRSKLEQILNIHKPNYLDSTFQELLPNFCKGFLF
SEKWVKWIKIVLLGTLILLGVKYYYEEMQGKNCALYLPRNLRYAFRPPEN
CNFCANIKNVPRLKNISPQEFEKKFAYSAAPVIISDATKNWTAVSLFNYW
YFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDRVELKPGEQPW
YFGWSNCHAETAEEFRRHYGRPYFLPEGSENNAVDWFFIGLSGLGAQMHI
DNVRLPSWQAQLAGSKRWLLVPPPECYLQCRRFDVVVQQGDIIVLDTNKW
YHQTFVQPGAISLTIGAEYD*

IP07882.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18612-PA 243 GF18612-PA 1..243 78..320 1185 87.7 Plus
Dana\GF10062-PA 330 GF10062-PA 71..329 62..319 425 36.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16773-PA 248 GG16773-PA 74..248 146..320 949 97.7 Plus
Dere\GG14606-PA 330 GG14606-PA 71..329 62..319 403 33.6 Plus
Dere\GG16773-PA 248 GG16773-PA 1..73 9..81 260 80.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12986-PA 307 GH12986-PA 1..307 14..320 1212 70.4 Plus
Dgri\GH17492-PA 307 GH17492-PA 1..307 14..320 1208 70 Plus
Dgri\GH16228-PA 330 GH16228-PA 71..329 62..319 417 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14331-PC 312 CG14331-PC 1..312 9..320 1715 100 Plus
CG2211-PB 330 CG2211-PB 71..329 62..319 397 34 Plus
CG2211-PA 330 CG2211-PA 71..329 62..319 397 34 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22822-PA 307 GI22822-PA 1..307 14..320 1203 72 Plus
Dmoj\GI13374-PA 330 GI13374-PA 71..329 62..319 401 34.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23933-PA 245 GL23933-PA 71..245 146..320 886 90.9 Plus
Dper\GL16071-PA 330 GL16071-PA 77..329 66..319 409 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12914-PA 309 GA12914-PA 3..309 14..320 1291 77.2 Plus
Dpse\GA28477-PA 330 GA28477-PA 77..329 66..319 409 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15362-PA 179 GM15362-PA 5..179 146..320 954 99.4 Plus
Dsec\GM14219-PA 330 GM14219-PA 71..329 62..319 409 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20232-PA 263 GD20232-PA 1..263 9..320 1186 77.9 Plus
Dsim\GD13482-PA 330 GD13482-PA 71..329 62..319 403 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22823-PA 307 GJ22823-PA 1..307 14..320 1208 73 Plus
Dvir\GJ13204-PA 330 GJ13204-PA 71..329 62..319 412 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11452-PA 280 GK11452-PA 82..251 146..315 846 87.6 Plus
Dwil\GK25450-PA 328 GK25450-PA 69..327 62..319 427 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25270-PA 248 GE25270-PA 45..248 120..320 944 86.3 Plus
Dyak\GE20966-PA 330 GE20966-PA 71..329 62..319 408 34 Plus
Dyak\GE14731-PA 74 GE14731-PA 1..73 9..81 274 74 Plus
Dyak\GE25270-PA 248 GE25270-PA 1..73 9..81 272 74 Plus