Clone IP07884 Report

Search the DGRC for IP07884

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:78
Well:84
Vector:pOT2
Associated Gene/TranscriptNijC-RB
Protein status:IP07884.pep: gold
Preliminary Size:699
Sequenced Size:771

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14394 2005-01-01 Successful iPCR screen
CG14394 2008-04-29 Release 5.5 accounting
CG14394 2008-08-15 Release 5.9 accounting
CG14394 2008-12-18 5.12 accounting

Clone Sequence Records

IP07884.complete Sequence

771 bp (771 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022535

> IP07884.complete
TTAAATCGCTTGGTTGTGTCGGCAACCGTCGCCACGACAACGCCGCTCCA
AGCACAAACAATTAGTTGCCAATTTCAGGAGACAATGAAAACCGAAACAA
CTTGAATTGAATGTTGTTGTGAGTTCTTTTGACTGACACAAAAACTGATC
CAAAGTGCAGTGGTGTGTGGCGAAAAACAAAGCTCCAACCGAAAGCAAAA
CCGAAAAACCAAAGATTCATTCATTATGGCATCAGGTTTGCAGCGGGTTA
ACGAAAATGAGATGAAGGCAATGGATGCCAATAGGTATGCCACCAAGAAG
ACGATCGCCCAGGGCATGCTGGACATCGCCCTGCTGACCGCCAATGCCTC
GCAGCTGAAGTACATCCTCCAGGTGGGCGAACAGCACCAGTTCTACAAGC
TGATGCTGATCCTGATCAGTCTGTCCATAGTCATGCAGGTGGCTGCTGGA
CTCTTGCTGGTCATTCAGTCCCTCATCAATATGCATAATACCAAGGATCG
AAATCGGGGCTTCGCCATCAACCACTTCATAGATGCCTTCATATTCCTGT
CCGTGTTTTGTGACATCATGAAGATGAATTTTGGACTGGATCCGGCGGTT
CCTCACACAGATGTGGAACTTCTGAAGCCCTGAATTTTTGAAATCACAGC
TGAGGTTAAATTTTGATGAACGACGTAGGCTCAGTGTTTTAAATACACTT
GCTTGCCACATTGTATATATAAATTTTTACCAAAAAAAAAGCAAATTTCT
ATTAAAAAAAAAAAAAAAAAA

IP07884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14394-RB 812 CG14394-RB 58..812 1..755 3775 100 Plus
CG14394-RG 706 CG14394-RG 51..544 262..755 2470 100 Plus
CG14394-RC 636 CG14394-RC 1..440 1..440 2200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8522305..8522622 436..753 1590 100 Plus
chr3R 27901430 chr3R 8520388..8520648 1..261 1305 100 Plus
chr3R 27901430 chr3R 8521364..8521545 260..441 895 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:53:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12697062..12697381 436..755 1600 100 Plus
3R 32079331 3R 12695146..12695406 1..261 1305 100 Plus
3R 32079331 3R 12696121..12696302 260..441 910 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12437893..12438212 436..755 1600 100 Plus
3R 31820162 3R 12435977..12436237 1..261 1305 100 Plus
3R 31820162 3R 12436952..12437133 260..441 910 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:00:20 has no hits.

IP07884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:01:38 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8520388..8520648 1..261 100 -> Plus
chr3R 8521366..8521542 262..438 99 -> Plus
chr3R 8522308..8522622 439..753 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:34:02 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..408 226..633 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:59 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..408 226..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:03:13 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
NijC-RB 1..408 226..633 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:03 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..408 226..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:21 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
NijC-RB 1..408 226..633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:21 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..753 1..753 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:59 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..753 1..753 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:03:13 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
NijC-RB 18..770 1..753 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:04 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
CG14394-RB 1..753 1..753 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:21 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
NijC-RB 18..770 1..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:38 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12696123..12696299 262..438 100 -> Plus
3R 12695146..12695406 1..261 100 -> Plus
3R 12697065..12697379 439..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:38 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12696123..12696299 262..438 100 -> Plus
3R 12695146..12695406 1..261 100 -> Plus
3R 12697065..12697379 439..753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:38 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12696123..12696299 262..438 100 -> Plus
3R 12695146..12695406 1..261 100 -> Plus
3R 12697065..12697379 439..753 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:03:13 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8520868..8521128 1..261 100 -> Plus
arm_3R 8521845..8522021 262..438 100 -> Plus
arm_3R 8522787..8523101 439..753 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:12 Download gff for IP07884.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12435977..12436237 1..261 100 -> Plus
3R 12436954..12437130 262..438 100 -> Plus
3R 12437896..12438210 439..753 100   Plus

IP07884.pep Sequence

Translation from 225 to 632

> IP07884.pep
MASGLQRVNENEMKAMDANRYATKKTIAQGMLDIALLTANASQLKYILQV
GEQHQFYKLMLILISLSIVMQVAAGLLLVIQSLINMHNTKDRNRGFAINH
FIDAFIFLSVFCDIMKMNFGLDPAVPHTDVELLKP*

IP07884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17117-PA 212 GF17117-PA 9..116 6..110 323 65.7 Plus
Dana\GF17117-PA 212 GF17117-PA 149..211 74..134 271 77.8 Plus
Dana\GF23821-PA 231 GF23821-PA 105..230 2..126 213 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19192-PA 203 GG19192-PA 1..142 13..122 299 48.6 Plus
Dere\GG13962-PA 235 GG13962-PA 106..219 2..115 210 37.7 Plus
Dere\GG16012-PA 180 GG16012-PA 57..148 5..96 150 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21383-PA 222 GH21383-PA 1..101 13..110 299 67.3 Plus
Dgri\GH15570-PA 228 GH15570-PA 106..219 8..121 226 40.4 Plus
Dgri\GH21383-PA 222 GH21383-PA 156..222 71..135 221 58.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
NijC-PB 135 CG14394-PB 1..135 1..135 675 100 Plus
NijC-PG 130 CG14394-PG 8..130 13..135 616 100 Plus
NijC-PD 138 CG14394-PD 1..122 1..122 398 66.4 Plus
NijC-PC 136 CG14394-PC 1..117 1..114 378 70.1 Plus
NijC-PF 133 CG14394-PF 8..117 13..122 339 62.7 Plus
NijC-PE 131 CG14394-PE 8..112 13..114 319 66.7 Plus
NijA-PD 225 CG6449-PD 95..221 4..126 227 38.6 Plus
NijA-PC 229 CG6449-PC 99..225 4..126 227 38.6 Plus
NijA-PA 241 CG6449-PA 111..237 4..126 227 38.6 Plus
NijA-PB 245 CG6449-PB 115..241 4..126 227 38.6 Plus
NijB-PA 181 CG11637-PA 75..172 19..119 146 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10503-PA 222 GI10503-PA 1..101 13..110 303 68.3 Plus
Dmoj\GI16845-PA 228 GI16845-PA 100..226 2..128 223 36.2 Plus
Dmoj\GI10503-PA 222 GI10503-PA 156..221 71..134 222 63.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24423-PA 181 GL24423-PA 4..176 1..135 318 45.7 Plus
Dper\GL20739-PA 243 GL20739-PA 115..235 3..121 224 39.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12950-PF 126 GA12950-PF 1..126 13..135 561 84.9 Plus
Dpse\GA12950-PE 141 GA12950-PE 4..136 1..135 380 59.3 Plus
Dpse\GA12950-PH 126 GA12950-PH 1..121 13..135 345 60.2 Plus
Dpse\GA12950-PC 126 GA12950-PC 1..122 13..133 305 60.5 Plus
Dpse\GA19603-PA 245 GA19603-PA 117..237 3..121 224 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24058-PA 170 GM24058-PA 1..154 1..122 363 53.2 Plus
Dsec\GM24060-PA 50 GM24060-PA 1..50 86..135 276 100 Plus
Dsec\GM15001-PA 177 GM15001-PA 75..148 19..96 139 34.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18856-PA 209 GD18856-PA 1..209 1..135 457 51.2 Plus
Dsim\GD12851-PA 246 GD12851-PA 111..231 2..122 228 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23184-PA 158 GJ23184-PA 1..101 13..110 303 68.3 Plus
Dvir\GJ12595-PA 230 GJ12595-PA 102..228 2..128 220 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13730-PA 235 GK13730-PA 1..101 13..110 290 65.3 Plus
Dwil\GK13730-PA 235 GK13730-PA 166..234 69..134 231 62.3 Plus
Dwil\GK17290-PA 226 GK17290-PA 97..220 2..124 214 36.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26216-PA 232 GE26216-PA 168..232 71..135 338 95.4 Plus
Dyak\GE26216-PA 232 GE26216-PA 1..142 13..122 296 48.6 Plus
Dyak\GE20261-PA 231 GE20261-PA 98..211 2..115 210 40.4 Plus
Dyak\GE19577-PA 180 GE19577-PA 76..149 21..94 134 33.8 Plus
Dyak\GE19573-PA 180 GE19573-PA 76..149 21..94 134 33.8 Plus

IP07884.hyp Sequence

Translation from 225 to 632

> IP07884.hyp
MASGLQRVNENEMKAMDANRYATKKTIAQGMLDIALLTANASQLKYILQV
GEQHQFYKLMLILISLSIVMQVAAGLLLVIQSLINMHNTKDRNRGFAINH
FIDAFIFLSVFCDIMKMNFGLDPAVPHTDVELLKP*

IP07884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
NijC-PB 135 CG14394-PB 1..135 1..135 675 100 Plus
NijC-PG 130 CG14394-PG 8..130 13..135 616 100 Plus
NijC-PD 138 CG14394-PD 1..122 1..122 398 66.4 Plus
NijC-PC 136 CG14394-PC 1..117 1..114 378 70.1 Plus
NijC-PF 133 CG14394-PF 8..117 13..122 339 62.7 Plus